Drug General Information (ID: DDIZ7J8S40)
  Drug Name Disulfiram Drug Info Tipranavir Drug Info
  Drug Type Small molecule Small molecule
  Therapeutic Class Alcohol Deterrents Anti-Hiv Agents
  Structure

 Mechanism of Disulfiram-Tipranavir Interaction (Severity Level: Major)
     Non-CYP450 enzyme inhibition Click to Show/Hide Mechanism Graph
Could Not Find 2D Structure
      Drug Name Disulfiram Tipranavir
      Mechanism Aldehyde dehydrogenase inhibitor Aldehyde dehydrogenase substrate
      Key Mechanism Factor 1
Factor Name Aldehyde dehydrogenase 1
×
Structure Sequence
MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS
Gene Name ALDH1A1
Uniprot ID AL1A1_HUMAN
KEGG Pathway hsa:216
Protein Family Aldehyde dehydrogenase family
Protein Function
Cytosolic dehydrogenase that catalyzes the irreversible oxidation of a wide range of aldehydes to their corresponding carboxylic acid (PubMed:19296407, PubMed:12941160, PubMed:15623782, PubMed:17175089, PubMed:26373694, PubMed:25450233). Functions downstream of retinol dehydrogenases and catalyzes the oxidation of retinaldehyde into retinoic acid, the second step in the oxidation of retinol/vitamin A into retinoic acid (By similarity). This pathway is crucial to control the levels of retinol and retinoic acid, two important molecules which excess can be teratogenic and cytotoxic (By similarity). Also oxidizes aldehydes resulting from lipid peroxidation like (E)-4-hydroxynon-2-enal/HNE, malonaldehyde and hexanal that form protein adducts and are highly cytotoxic. By participating for instance to the clearance of (E)-4-hydroxynon-2-enal/HNE in the lens epithelium prevents the formation of HNE-protein adducts and lens opacification (PubMed:19296407, PubMed:12941160, PubMed:15623782). Functions also downstream of fructosamine-3-kinase in the fructosamine degradation pathway by catalyzing the oxidation of 3-deoxyglucosone, the carbohydrate product of fructosamine 3-phosphate decomposition, which is itself a potent glycating agent that may react with lysine and arginine side-chains of proteins (PubMed:17175089). Has also an aminobutyraldehyde dehydrogenase activity and is probably part of an alternative pathway for the biosynthesis of GABA/4-aminobutanoate in midbrain, thereby playing a role in GABAergic synaptic transmission (By similarity).
    Click to Show/Hide
      Mechanism Description
  • Decreased metabolism of Tipranavir caused by Disulfiram mediated inhibition of non-CYP450 enzyme

Recommended Action
      Management Concomitant use of tipranavir capsules and disulfiram should be avoided.

References
1 Elenbaas RM "Drug therapy reviews: management of the disulfiram-alcohol reaction." Am J Hosp Pharm 34 (1977): 827-31. [PMID: 331944]
2 Jones RO "Death following the ingestion of alcohol in an antabuse treated patient." Can Med Assoc J 60 (1949): 609-12. [PMID: 18127717]
3 Product Information. Antabuse (disulfiram). Wyeth-Ayerst Laboratories, Philadelphia, PA.
4 Product Information. Aptivus (tipranavir). Boehringer-Ingelheim, Ridgefield, CT.
5 Stoll D, King LE "Disulfiram-alcohol skin reaction to beer-containing shampoo." JAMA 244 (1980): 2045. [PMID: 6448928]
6 van Ieperen L "Sudden death during disulfiram-ethanol reaction." S Afr Med J 66 (1984): 165. [PMID: 6463790]