Details of Drug Interaction

Details of Drug-Drug Interaction

 Drug General Information (ID: DDIQ9IOJKF)
  Drug Name Aliskiren Drug Info Garlic Drug Info
  Drug Type Small molecule Natural product
  Therapeutic Class Antihypertensive Agents Herbal Products

 Mechanism of Aliskiren-Garlic Interaction (Severity Level: Minor)
     Additive hypotensive effects Click to Show/Hide Mechanism Graph
Could Not Find 2D Structure
      Drug Name Aliskiren Garlic
      Mechanism 1 Antihypertensive agent
Angiotensinogenase  Inhibitor 		Antihypertensive agent
      Key Mechanism Factor 1
Factor Name Angiotensinogenase renin
×
Structure Sequence
MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
Gene Name REN
Uniprot ID RENI_HUMAN
KEGG Pathway hsa:5972
Protein Family Peptidase A1 family
Protein Function
Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney.
    Click to Show/Hide
      Mechanism Description
  • Additive hypotensive effects by the combination of Aliskiren and Garlic 
      Mechanism 2 Antihypertensive agent
Angiotensinogenase  Inhibitor 		Hypotensive effects
      Key Mechanism Factor 2
Factor Name Angiotensinogenase renin
×
Structure Sequence
MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
Gene Name REN
Uniprot ID RENI_HUMAN
KEGG Pathway hsa:5972
Protein Family Peptidase A1 family
Protein Function
Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney.
    Click to Show/Hide
      Mechanism Description
  • Additive hypotensive effects by the combination of Aliskiren and Garlic 

References
1 Tattelman E "Health effects of garlic." Am Fam Physician 72 (2005): 103-6
2 Richard CL, Jurgens TM "Effects of natural health products on blood pressure." Ann Pharmacother 39 (2005): 712-20