Drug General Information (ID: DDILGXUQH9)
  Drug Name Amprenavir (oral solution) Drug Info Metronidazole Drug Info
  Drug Type Small molecule Small molecule
  Therapeutic Class Anti-Hiv Agents Antiinfective Agents
  Structure

 Mechanism of Amprenavir (oral solution)-Metronidazole Interaction (Severity Level: Major)
     Non-CYP450 enzyme inhibition Click to Show/Hide Mechanism Graph
Could Not Find 2D Structure
      Drug Name Amprenavir (oral solution) Metronidazole
      Mechanism Aldehyde dehydrogenase substrate Aldehyde dehydrogenase inhibitor
      Key Mechanism Factor 1
Factor Name Aldehyde dehydrogenase 1
×
Structure Sequence
MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS
Gene Name ALDH1A1
Uniprot ID AL1A1_HUMAN
KEGG Pathway hsa:216
Protein Family Aldehyde dehydrogenase family
Protein Function
Cytosolic dehydrogenase that catalyzes the irreversible oxidation of a wide range of aldehydes to their corresponding carboxylic acid (PubMed:19296407, PubMed:12941160, PubMed:15623782, PubMed:17175089, PubMed:26373694, PubMed:25450233). Functions downstream of retinol dehydrogenases and catalyzes the oxidation of retinaldehyde into retinoic acid, the second step in the oxidation of retinol/vitamin A into retinoic acid (By similarity). This pathway is crucial to control the levels of retinol and retinoic acid, two important molecules which excess can be teratogenic and cytotoxic (By similarity). Also oxidizes aldehydes resulting from lipid peroxidation like (E)-4-hydroxynon-2-enal/HNE, malonaldehyde and hexanal that form protein adducts and are highly cytotoxic. By participating for instance to the clearance of (E)-4-hydroxynon-2-enal/HNE in the lens epithelium prevents the formation of HNE-protein adducts and lens opacification (PubMed:19296407, PubMed:12941160, PubMed:15623782). Functions also downstream of fructosamine-3-kinase in the fructosamine degradation pathway by catalyzing the oxidation of 3-deoxyglucosone, the carbohydrate product of fructosamine 3-phosphate decomposition, which is itself a potent glycating agent that may react with lysine and arginine side-chains of proteins (PubMed:17175089). Has also an aminobutyraldehyde dehydrogenase activity and is probably part of an alternative pathway for the biosynthesis of GABA/4-aminobutanoate in midbrain, thereby playing a role in GABAergic synaptic transmission (By similarity).
    Click to Show/Hide
      Mechanism Description
  • Decreased metabolism of Amprenavir (oral solution) caused by Metronidazole mediated inhibition of non-CYP450 enzyme

Recommended Action
      Management The use of amprenavir oral solution with disulfiram or metronidazole (oral, intravenous, and probably vaginal preparations) is considered contraindicated. Given their structural similarities to metronidazole, the same precaution may be applicable to other nitroimidazoles such as benznidazole and tinidazole, although clinical data are lacking.

References
1 Product Information. Agenerase (amprenavir). Glaxo Wellcome, Research Triangle Pk, NC.
2 Product Information. Flagyl (metronidazole). Searle, Skokie, IL.
3 Product Information. Metrogel-Vaginal (metronidazole). Curatek Pharmaceuticals Ltd, Elk Grove Village, IL.
4 Product Information. Tindamax (tinidazole). Presutti Laboratories Inc, Arlington Heights, IL.