Details of Drug Interaction

Details of Drug-Drug Interaction

 Drug General Information (ID: DDIH4TXWI2)
  Drug Name Maraviroc Drug Info Aliskiren Drug Info
  Drug Type Small molecule Small molecule
  Therapeutic Class Anti-Hiv Agents Antihypertensive Agents
  Structure

 Mechanism of Maraviroc-Aliskiren Interaction (Severity Level: Moderate)
     Additive hypotensive effects Click to Show/Hide Mechanism Graph
Could Not Find 2D Structure
      Drug Name Maraviroc Aliskiren
      Mechanism 1 Antihypertensive agent Antihypertensive agent
Angiotensinogenase  Inhibitor
      Key Mechanism Factor 1
Factor Name Angiotensinogenase renin
×
Structure Sequence
MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
Gene Name REN
Uniprot ID RENI_HUMAN
KEGG Pathway hsa:5972
Protein Family Peptidase A1 family
Protein Function
Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney.
    Click to Show/Hide
      Mechanism Description
  • Additive hypotensive effects by the combination of Maraviroc and Aliskiren 
      Mechanism 2 Hypotensive effects Antihypertensive agent
Angiotensinogenase  Inhibitor
      Key Mechanism Factor 2
Factor Name Angiotensinogenase renin
×
Structure Sequence
MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
Gene Name REN
Uniprot ID RENI_HUMAN
KEGG Pathway hsa:5972
Protein Family Peptidase A1 family
Protein Function
Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney.
    Click to Show/Hide
      Mechanism Description
  • Additive hypotensive effects by the combination of Maraviroc and Aliskiren 

Recommended Action
      Management Caution is advised when maraviroc is prescribed to patients on concomitant medications known to lower blood pressure. Close monitoring for development of hypotension is recommended. Ambulatory patients should be advised to avoid rising abruptly from a sitting or recumbent position and to notify their doctor if they experience dizziness, lightheadedness, syncope, orthostasis, or tachycardia.

References
1 Product Information. Selzentry (maraviroc). Pfizer U.S. Pharmaceuticals Group, New York, NY.