Drug General Information (ID: DDIE8W0ZRX)
  Drug Name Budesonide Drug Info Aliskiren Drug Info
  Drug Type Small molecule Small molecule
  Therapeutic Class Antiinflammatory Agents Antihypertensive Agents
  Structure

 Mechanism of Budesonide-Aliskiren Interaction (Severity Level: Moderate)
     Antagonize the effect of antihypertensive agents Click to Show/Hide Mechanism Graph
Could Not Find 2D Structure
      Drug Name Budesonide Aliskiren
      Mechanism Hypertensive effects
Induction of sodium and fluid retention 
Antihypertensive agent
Angiotensinogenase  Inhibitor
      Key Mechanism Factor 1
Factor Name Angiotensinogenase renin
×
Structure Sequence
MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
Gene Name REN
Uniprot ID RENI_HUMAN
KEGG Pathway hsa:5972
Protein Family Peptidase A1 family
Protein Function
Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney.
    Click to Show/Hide
      Mechanism Description
  • Antagonize the effect of Budesonide when combined with Aliskiren 

Recommended Action
      Management Patients on prolonged (i.e., longer than about a week) or high-dose corticosteroid therapy should have blood pressure, electrolyte levels, and body weight monitored regularly, and be observed for the development of edema and congestive heart failure. The dosages of antihypertensive medications may require adjustment.

References
1 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
2 Multum Information Services, Inc. Expert Review Panel.