Details of Drug Interaction

Details of Drug-Drug Interaction

 Drug General Information (ID: DDIE7W3SMX)
  Drug Name Ambrisentan Drug Info Licorice Drug Info
  Drug Type Small molecule Natural product
  Therapeutic Class Agents For Pulmonary Hypertension Herbal Products
  Structure

 Mechanism of Ambrisentan-Licorice Interaction (Severity Level: Moderate)
     Antagonize the effect of antihypertensive agents Click to Show/Hide Mechanism Graph
Could Not Find 2D Structure
      Drug Name Ambrisentan Licorice
      Mechanism Antihypertensive agent
Endothelin receptor  Antagonist 		Hypertensive effects
Mineralocorticoid and renin-suppressing effects 
      Key Mechanism Factor 1
Factor Name Endothelin A receptor
×
Structure Sequence
METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN
Gene Name EDNRA
Uniprot ID EDNRA_HUMAN
KEGG Pathway hsa:1909
Protein Family G-protein coupled receptor 1 family
Protein Function
Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3.
    Click to Show/Hide
      Mechanism Description
  • Antagonize the effect of Ambrisentan when combined with Licorice 

Recommended Action
      Management Patients receiving antihypertensive therapy should avoid or limit the consumption of licorice-containing products. Even relatively moderate doses of licorice may be problematic in susceptible patients when ingested regularly for prolonged periods.

References
1 Stewart PM, Wallace AM, Valentino R, Burt D, Shackleton CH, Edwards CR "Mineralocorticoid activity of liquorice: 11-beta-hydroxysteroid dehydrogenase deficiency comes of age." Lancet 2 (1987): 821-4. [PMID: 2889032]
2 Cumming AM "Metabolic effects of licorice." Br Med J 1 (1977): 906
3 Epstein MT, Espiner EA, Donald RA, Hughes H "Effect of eating liquorice on the renin-angiotensin aldosterone axis in normal subjects." Br Med J 1 (1977): 488-90