Details of Drug Interaction

Details of Drug-Drug Interaction

 Drug General Information (ID: DDIE2G85Y3)
  Drug Name Iloprost Drug Info Licorice Drug Info
  Drug Type Small molecule Natural product
  Therapeutic Class Antihypertensive Agents Herbal Products
  Structure

 Mechanism of Iloprost-Licorice Interaction (Severity Level: Moderate)
     Antagonize the effect of antihypertensive agents Click to Show/Hide Mechanism Graph
Could Not Find 2D Structure
      Drug Name Iloprost Licorice
      Mechanism Antihypertensive agent
Prostaglandin E2 receptor  Agonist 		Hypertensive effects
Mineralocorticoid and renin-suppressing effects 
      Key Mechanism Factor 1
Factor Name Prostaglandin E2 receptor EP2
×
Structure Sequence
MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGRRSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFSLATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQYCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGSGRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQALRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
Gene Name PTGER2
Uniprot ID PE2R2_HUMAN
KEGG Pathway hsa:5732
Protein Family G-protein coupled receptor 1 family
Protein Function
Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. The subsequent raise in intracellular cAMP is responsible for the relaxing effect of this receptor on smooth muscle.
    Click to Show/Hide
      Mechanism Description
  • Antagonize the effect of Iloprost when combined with Licorice 

Recommended Action
      Management Patients receiving antihypertensive therapy should avoid or limit the consumption of licorice-containing products. Even relatively moderate doses of licorice may be problematic in susceptible patients when ingested regularly for prolonged periods.

References
1 Stewart PM, Wallace AM, Valentino R, Burt D, Shackleton CH, Edwards CR "Mineralocorticoid activity of liquorice: 11-beta-hydroxysteroid dehydrogenase deficiency comes of age." Lancet 2 (1987): 821-4. [PMID: 2889032]
2 Cumming AM "Metabolic effects of licorice." Br Med J 1 (1977): 906
3 Epstein MT, Espiner EA, Donald RA, Hughes H "Effect of eating liquorice on the renin-angiotensin aldosterone axis in normal subjects." Br Med J 1 (1977): 488-90