Details of Drug-Drug Interaction
| Drug General Information (ID: DDICL0546T) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Drug Name | Riociguat | Drug Info | Aliskiren | Drug Info | |||||
| Drug Type | Small molecule | Small molecule | |||||||
| Therapeutic Class | Vasodilator Agents | Antihypertensive Agents | |||||||
| Structure | |||||||||
| Mechanism of Riociguat-Aliskiren Interaction (Severity Level: Moderate) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Additive hypotensive effects Click to Show/Hide Mechanism Graph | |||||||||
 |
|||||||||
| Drug Name | Riociguat | Aliskiren | |||||||
| Mechanism |
Hypotensive effects Soluble guanylyl cyclase Agonist |
Antihypertensive agent Angiotensinogenase Inhibitor |
|||||||
| Key Mechanism Factor 1 | |||||||||
| Factor Name | Guanylate cyclase soluble | Structure Sequence | |||||||
| Protein Family | Adenylyl cyclase class-4/guanylyl cyclase family | ||||||||
| Protein Function |
Mediates responses to nitric oxide (NO) by catalyzing the biosynthesis of the signaling molecule cGMP.
Click to Show/Hide
|
||||||||
| Key Mechanism Factor 2 | |||||||||
| Factor Name | Angiotensinogenase renin |
×
Structure
Sequence
MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
|
|||||||
| Gene Name | REN | ||||||||
| Uniprot ID | RENI_HUMAN | ||||||||
| KEGG Pathway | hsa:5972 | ||||||||
| Protein Family | Peptidase A1 family | ||||||||
| Protein Function |
Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney.
Click to Show/Hide
|
||||||||
| Mechanism Description |
|
||||||||
| Recommended Action | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Management | Caution is advised if riociguat is prescribed in combination with antihypertensive agents or other vasodilators. | ||||||||
| References | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 1 | Product Information. Adempas (riociguat). Bayer Pharmaceutical Inc, West Haven, CT. | ||||||||||||||||||