Details of Drug Interaction

Details of Drug-Drug Interaction

 Drug General Information (ID: DDI2XDO9J3)
  Drug Name Bosentan Drug Info Pentoxifylline Drug Info
  Drug Type Small molecule Small molecule
  Therapeutic Class Antihypertensive Agents Vasodilator Agents
  Structure

 Mechanism of Bosentan-Pentoxifylline Interaction (Severity Level: Moderate)
     Additive hypotensive effects Click to Show/Hide Mechanism Graph
Could Not Find 2D Structure
      Drug Name Bosentan Pentoxifylline
      Mechanism 1 Antihypertensive agent
Endothelin receptor  Antagonist 		Antihypertensive agent
      Key Mechanism Factor 1
Factor Name Endothelin A receptor
×
Structure Sequence
METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN
Gene Name EDNRA
Uniprot ID EDNRA_HUMAN
KEGG Pathway hsa:1909
Protein Family G-protein coupled receptor 1 family
Protein Function
Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3.
    Click to Show/Hide
      Mechanism Description
  • Additive hypotensive effects by the combination of Bosentan and Pentoxifylline 
      Mechanism 2 Antihypertensive agent
Endothelin receptor  Antagonist 		Hypotensive effects
      Key Mechanism Factor 2
Factor Name Endothelin A receptor
×
Structure Sequence
METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN
Gene Name EDNRA
Uniprot ID EDNRA_HUMAN
KEGG Pathway hsa:1909
Protein Family G-protein coupled receptor 1 family
Protein Function
Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3.
    Click to Show/Hide
      Mechanism Description
  • Additive hypotensive effects by the combination of Bosentan and Pentoxifylline 

Recommended Action
      Management Caution is advised if pentoxifylline is used in combination with hypotensive agents. Periodic systemic blood pressure monitoring is recommended.

References
1 Product Information. Trental (pentoxifylline). Hoechst Marion-Roussel Inc, Kansas City, MO.