Drug General Information (ID: DDI2T4Y9WP)
  Drug Name Ambrisentan Drug Info Riociguat Drug Info
  Drug Type Small molecule Small molecule
  Therapeutic Class Agents For Pulmonary Hypertension Vasodilator Agents
  Structure

 Mechanism of Ambrisentan-Riociguat Interaction (Severity Level: Moderate)
     Additive hypotensive effects Click to Show/Hide Mechanism Graph
Could Not Find 2D Structure
      Drug Name Ambrisentan Riociguat
      Mechanism Antihypertensive agent
Endothelin receptor  Antagonist
Hypotensive effects
Soluble guanylyl cyclase  Agonist
      Key Mechanism Factor 1
Factor Name Endothelin A receptor
×
Structure Sequence
METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN
Gene Name EDNRA
Uniprot ID EDNRA_HUMAN
KEGG Pathway hsa:1909
Protein Family G-protein coupled receptor 1 family
Protein Function
Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3.
    Click to Show/Hide
      Key Mechanism Factor 2
Factor Name Guanylate cyclase soluble Structure Sequence
Protein Family Adenylyl cyclase class-4/guanylyl cyclase family
Protein Function
Mediates responses to nitric oxide (NO) by catalyzing the biosynthesis of the signaling molecule cGMP.
    Click to Show/Hide
      Mechanism Description
  • Additive hypotensive effects by the combination of Ambrisentan and Riociguat 

Recommended Action
      Management Caution is advised if riociguat is prescribed in combination with antihypertensive agents or other vasodilators.

References
1 Product Information. Adempas (riociguat). Bayer Pharmaceutical Inc, West Haven, CT.