Details of Drug-Drug Interaction
| Drug General Information (ID: DDI2T4Y9WP) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Drug Name | Ambrisentan | Drug Info | Riociguat | Drug Info | |||||
| Drug Type | Small molecule | Small molecule | |||||||
| Therapeutic Class | Agents For Pulmonary Hypertension | Vasodilator Agents | |||||||
| Structure | |||||||||
| Mechanism of Ambrisentan-Riociguat Interaction (Severity Level: Moderate) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Additive hypotensive effects Click to Show/Hide Mechanism Graph | |||||||||
 |
|||||||||
| Drug Name | Ambrisentan | Riociguat | |||||||
| Mechanism |
Antihypertensive agent Endothelin receptor Antagonist |
Hypotensive effects Soluble guanylyl cyclase Agonist |
|||||||
| Key Mechanism Factor 1 | |||||||||
| Factor Name | Endothelin A receptor |
×
Structure
Sequence
METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN
|
|||||||
| Gene Name | EDNRA | ||||||||
| Uniprot ID | EDNRA_HUMAN | ||||||||
| KEGG Pathway | hsa:1909 | ||||||||
| Protein Family | G-protein coupled receptor 1 family | ||||||||
| Protein Function |
Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3.
Click to Show/Hide
|
||||||||
| Key Mechanism Factor 2 | |||||||||
| Factor Name | Guanylate cyclase soluble | Structure Sequence | |||||||
| Protein Family | Adenylyl cyclase class-4/guanylyl cyclase family | ||||||||
| Protein Function |
Mediates responses to nitric oxide (NO) by catalyzing the biosynthesis of the signaling molecule cGMP.
Click to Show/Hide
|
||||||||
| Mechanism Description |
|
||||||||
| Recommended Action | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Management | Caution is advised if riociguat is prescribed in combination with antihypertensive agents or other vasodilators. | ||||||||
| References | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 1 | Product Information. Adempas (riociguat). Bayer Pharmaceutical Inc, West Haven, CT. | ||||||||||||||||||