Drug General Information (ID: DDIYJFH8B4)
  Drug Name Dofetilide Drug Info Megestrol acetate Drug Info
  Drug Type Small molecule Small molecule
  Therapeutic Class Antiarrhythmic Agents Hormones/Antineoplastics
  Structure

 Mechanism of Dofetilide-Megestrol acetate Interaction (Severity Level: Major)
     Transporter inhibition Click to Show/Hide Mechanism Graph
Could Not Find 2D Structure
      Drug Name Dofetilide Megestrol acetate
      Mechanism OCT2 substrate OCT2 inhibitor
      Key Mechanism Factor 1
Factor Name Solute carrier family 22 member 2
×
Structure Sequence
MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHRCRSPGVAELSLRCGWSPAEELNYTVPGPGPAGEASPRQCRRYEVDWNQSTFDCVDPLASLDTNRSRLPLGPCRDGWVYETPGSSIVTEFNLVCANSWMLDLFQSSVNVGFFIGSMSIGYIADRFGRKLCLLTTVLINAAAGVLMAISPTYTWMLIFRLIQGLVSKAGWLIGYILITEFVGRRYRRTVGIFYQVAYTVGLLVLAGVAYALPHWRWLQFTVSLPNFFFLLYYWCIPESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIRKHTMILMYNWFTSSVLYQGLIMHMGLAGDNIYLDFFYSALVEFPAAFMIILTIDRIGRRYPWAASNMVAGAACLASVFIPGDLQWLKIIISCLGRMGITMAYEIVCLVNAELYPTFIRNLGVHICSSMCDIGGIITPFLVYRLTNIWLELPLMVFGVLGLVAGGLVLLLPETKGKALPETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN
Gene Name 44836
Uniprot ID S22A2_HUMAN
KEGG Pathway hsa:6582
Protein Family Major facilitator (TC 2.A.1) superfamily
Protein Function
Mediates tubular uptake of organic compounds from circulation. Mediates the influx of agmatine, dopamine, noradrenaline (norepinephrine), serotonin, choline, famotidine, ranitidine, histamine, creatinine, amantadine, memantine, acriflavine, 4-[4-(dimethylamino)-styryl]-N-methylpyridinium ASP, amiloride, metformin, N-1-methylnicotinamide (NMN), tetraethylammonium (TEA), 1-methyl-4-phenylpyridinium (MPP), cimetidine, cisplatin and oxaliplatin. Cisplatin may develop a nephrotoxic action. Transport of creatinine is inhibited by fluoroquinolones such as DX-619 and LVFX. This transporter is a major determinant of the anticancer activity of oxaliplatin and may contribute to antitumor specificity.
    Click to Show/Hide
      Mechanism Description
  • Decreased clearance of Dofetilide due to the transporter inhibition by Megestrol acetate 

Recommended Action
      Management Given the risk of concentration-dependent QT prolongation, concomitant use of dofetilide with OCT-2 inhibitors is considered contraindicated.

References
1 Product Information. Tikosyn (dofetilide) Pfizer US Pharmaceuticals, Atlanta, GA.
2 Abel S, Nichols DJ, Brearley CJ, Eve MD "Effect of cimetidine and ranitidine on pharmacokinetics and pharmacodynamics of a single dose of dofetilide." Br J Clin Pharmacol 49 (2000): 64-71.[PMID: 10606839]
3 Johnson BF, Cheng SL, Venitz J "Transient kinetic and dynamic interactions between verapamil and dofetilide, a class III antiarrhythmic." J Clin Pharmacol 41 (2001): 1248-56.[PMID: 11697758]