Details of Drug-Drug Interaction
| Drug General Information (ID: DDIXICZEGF) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Drug Name | Prasugrel | Drug Info | Cangrelor | Drug Info | |||||
| Drug Type | Small molecule | Small molecule | |||||||
| Therapeutic Class | Antiplatelet Agents | Antiplatelet Agents | |||||||
| Structure | |||||||||
| Mechanism of Prasugrel-Cangrelor Interaction (Severity Level: Major) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Attenuated pharmacological effects (Unspecific) Click to Show/Hide Mechanism Graph | |||||||||
| Drug Name | Prasugrel | Cangrelor | |||||||
| Mechanism |
Prasugrel Irreversible P2Y12 inhibitor Inhibitor |
Decrease the antiplatelet activities of prasugrel Reversible P2Y12 inhibitor Inhibitor |
|||||||
| Key Mechanism Factor 1 | |||||||||
| Factor Name | P2Y purinoceptor 12 |
×
Structure
Sequence
MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
|
|||||||
| Gene Name | P2RY12 | ||||||||
| Uniprot ID | P2Y12_HUMAN | ||||||||
| KEGG Pathway | hsa:64805 | ||||||||
| Protein Family | G-protein coupled receptor 1 family | ||||||||
| Protein Function |
Receptor for ADP and ATP coupled to G-proteins that inhibit the adenylyl cyclase second messenger system. Not activated by UDP and UTP. Required for normal platelet aggregation and blood coagulation.
Click to Show/Hide
|
||||||||
| Key Mechanism Factor 2 | |||||||||
| Factor Name | P2Y purinoceptor 12 |
×
Structure
Sequence
MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
|
|||||||
| Gene Name | P2RY12 | ||||||||
| Uniprot ID | P2Y12_HUMAN | ||||||||
| KEGG Pathway | hsa:64805 | ||||||||
| Protein Family | G-protein coupled receptor 1 family | ||||||||
| Protein Function |
Receptor for ADP and ATP coupled to G-proteins that inhibit the adenylyl cyclase second messenger system. Not activated by UDP and UTP. Required for normal platelet aggregation and blood coagulation.
Click to Show/Hide
|
||||||||
| Mechanism Description |
|
||||||||
| Recommended Action | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Management | To maintain platelet inhibition, clopidogrel 600 mg or prasugrel 60 mg should be administered immediately after discontinuation of the cangrelor infusion. Do not administer prior to discontinuation of cangrelor, as clopidogrel and prasugrel will have no antiplatelet effect until the next dose is administered. alternatively, ticagrelor 180 mg may be administered at any time during cangrelor infusion or immediately after discontinuation. | ||||||||
