Details of Drug-Drug Interaction
| Drug General Information (ID: DDIX9CVBEI) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Drug Name | Desmopressin | Drug Info | Tolvaptan | Drug Info | |||||
| Drug Type | Small molecule | Small molecule | |||||||
| Therapeutic Class | Antidiuretic Hormones | Vasopressin Antagonists | |||||||
| Structure | |||||||||
| Mechanism of Desmopressin-Tolvaptan Interaction (Severity Level: Moderate) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Attenuated pharmacological effects (Unspecific) Click to Show/Hide Mechanism Graph | |||||||||
| Drug Name | Desmopressin | Tolvaptan | |||||||
| Mechanism | Vasopressin V2 receptor agonist | Vasopressin V2 receptor antagonist | |||||||
| Key Mechanism Factor 1 | |||||||||
| Factor Name | Vasopressin V2 receptor |
×
Structure
Sequence
MLMASTTSAVPGHPSLPSLPSNSSQERPLDTRDPLLARAELALLSIVFVAVALSNGLVLAALARRGRRGHWAPIHVFIGHLCLADLAVALFQVLPQLAWKATDRFRGPDALCRAVKYLQMVGMYASSYMILAMTLDRHRAICRPMLAYRHGSGAHWNRPVLVAWAFSLLLSLPQLFIFAQRNVEGGSGVTDCWACFAEPWGRRTYVTWIALMVFVAPTLGIAACQVLIFREIHASLVPGPSERPGGRRRGRRTGSPGEGAHVSAAVAKTVRMTLVIVVVYVLCWAPFFLVQLWAAWDPEAPLEGAPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTTASSSLAKDTSS
|
|||||||
| Gene Name | AVPR2 ADHR DIR DIR3 V2R | ||||||||
| Uniprot ID | V2R_HUMAN | ||||||||
| KEGG Pathway | hsa:554 | ||||||||
| Protein Family | G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily | ||||||||
| Protein Function |
Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Involved in renal water reabsorption.
Click to Show/Hide
|
||||||||
| Mechanism Description |
|
||||||||
| Recommended Action | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Management | Concomitant use of tolvaptan with a V2-receptor agonist such as desmopressin is not recommended. | ||||||||
