Details of Drug-Drug Interaction
| Drug General Information (ID: DDIWN95RQ6) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Drug Name | Clidinium | Drug Info | Prucalopride | Drug Info | |||||
| Drug Type | Small molecule | Small molecule | |||||||
| Therapeutic Class | Analgesics | Serotoninergic Neuroenteric Modulators | |||||||
| Structure | |||||||||
| Mechanism of Clidinium-Prucalopride Interaction (Severity Level: Moderate) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Antagonize the effect of cholinergic agents Click to Show/Hide Mechanism Graph | |||||||||
![]() |
|||||||||
| Drug Name | Clidinium | Prucalopride | |||||||
| Mechanism |
Anticholinergic effects Muscarinic acetylcholine receptor Antagonist |
Cholinergic effects 5-HT 4 receptor Agonist |
|||||||
| Key Mechanism Factor 1 | |||||||||
| Factor Name | Muscarinic acetylcholine receptor M | Structure Sequence | |||||||
| Protein Family | G-protein coupled receptor 1 family | ||||||||
| Protein Function |
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.
Click to Show/Hide
|
||||||||
| Key Mechanism Factor 2 | |||||||||
| Factor Name | 5-HT 4 receptor |
×
Structure
Sequence
MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRPQSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSDT
|
|||||||
| Gene Name | HTR4 | ||||||||
| Uniprot ID | 5HT4R_HUMAN | ||||||||
| KEGG Pathway | hsa:3360 | ||||||||
| Protein Family | G-protein coupled receptor 1 family | ||||||||
| Protein Function |
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase.
Click to Show/Hide
|
||||||||
| Mechanism Description |
|
||||||||
| Recommended Action | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Management | Monitoring for altered efficacy of prucalopride may be advisable during concomitant use with anticholinergic agents. | ||||||||
| References | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 1 | EMEA. European Medicines Agency "EPARs. European Union Public Assessment Reports.". | ||||||||||||||||||
| 2 | Product Information. Resotran (prucalopride). Janssen Pharmaceuticals, Titusville, NJ. | ||||||||||||||||||

