Drug General Information (ID: DDIVH0JWTK)
  Drug Name Reserpine Drug Info Tetrabenazine Drug Info
  Drug Type Small molecule Small molecule
  Therapeutic Class Antihypertensive Agents Nephropathic Cystinosis Therapy
  Structure

 Mechanism of Reserpine-Tetrabenazine Interaction (Severity Level: Major)
     Additive antidopaminergic effects Click to Show/Hide Mechanism Graph
Could Not Find 2D Structure
      Drug Name Reserpine Tetrabenazine
      Mechanism Antidopaminergic effects
Synaptic vesicular amine transporter  Inhibitor
Antidopaminergic effects
Synaptic vesicular amine transporter  Inhibitor
      Key Mechanism Factor 1
Factor Name Synaptic vesicle amine transporter
×
Structure Sequence
MALSELALVRWLQESRRSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNATEIQTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKATVQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSSSYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNVMGIALGGLAMGVLVGPPFGSVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGRWLCALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDILFAPLCFFLRSPPAKEEKMAILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD
Gene Name SLC18A2
Uniprot ID VMAT2_HUMAN
KEGG Pathway hsa:6571
Protein Family Major facilitator superfamily
Protein Function
Involved in the ATP-dependent vesicular transport of biogenic amine neurotransmitters. Pumps cytosolic monoamines including dopamine, norepinephrine, serotonin, and histamine into synaptic vesicles (PubMed:23363473). Requisite for vesicular amine storage prior to secretion via exocytosis.
    Click to Show/Hide
      Mechanism Description
  • Additive antidopaminergic effects by the combination of Reserpine and Tetrabenazine 

Recommended Action
      Management Concomitant use of reserpine with either tetrabenazine or deutetrabenazine is considered contraindicated. Caution should be exercised when switching from reserpine to either medication. At least 20 days should elapse after stopping reserpine before initiating therapy with either tetrabenazine or deutetrabenazine. The physician is advised to wait for chorea to reemerge before administering tetrabenazine or deutetrabenazine to avoid monoamine over-depletion in the central nervous system.

References
1 Product Information. Xenazine (tetrabenazine). Prestwick Pharmaceuticals Inc, Washington DC, VA.
2 Product Information. Austedo (deutetrabenazine). Teva Pharmaceuticals USA, North Wales, PA.