Drug General Information (ID: DDIUKECL9Z)
  Drug Name Caffeine Drug Info Disulfiram Drug Info
  Drug Type Small molecule Small molecule
  Therapeutic Class Antihypertensive Agents Alcohol Deterrents
  Structure

 Mechanism of Caffeine-Disulfiram Interaction (Severity Level: Minor)
     CYP450 enzyme inhibition Click to Show/Hide Mechanism Graph
Could Not Find 2D Structure
      Drug Name Caffeine Disulfiram
      Mechanism CYP450 2E1 substrate CYP450 2E1 inhibitor
      Key Mechanism Factor 1
Factor Name Cytochrome P450 2E1
×
Structure Sequence
MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRLAQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGPTWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVIADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVAEVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGCIPPRYKLCVIPRS
Gene Name CYP2E1
Uniprot ID CP2E1_HUMAN
KEGG Pathway hsa:1571
Protein Family Cytochrome P450 family
Protein Function
A cytochrome P450 monooxygenase involved in the metabolism of fatty acids (PubMed:10553002, PubMed:18577768). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase) (PubMed:10553002, PubMed:18577768). Catalyzes the hydroxylation of carbon-hydrogen bonds. Hydroxylates fatty acids specifically at the omega-1 position displaying the highest catalytic activity for saturated fatty acids (PubMed:10553002, PubMed:18577768). May be involved in the oxidative metabolism of xenobiotics (Probable).
    Click to Show/Hide
      Mechanism Description
  • Decreased metabolism of Caffeine caused by Disulfiram mediated inhibition of CYP450 enzyme

References
1 Beach CA, Mays DC, Guiler RC, et al "Inhibition of elimination of caffeine by disulfiram in normal subjects and recovering alcoholics." Clin Pharmacol Ther 39 (1986): 265-70. [PMID: 3948467]