Drug General Information (ID: DDIUDNVQ7F)
  Drug Name Entacapone Drug Info Memantine Drug Info
  Drug Type Small molecule Small molecule
  Therapeutic Class Antiparkinson Agents Cholinesterase Inhibitors
  Structure

 Mechanism of Entacapone-Memantine Interaction (Severity Level: Minor)
     Additive dopaminergic effects Click to Show/Hide Mechanism Graph
Could Not Find 2D Structure
      Drug Name Entacapone Memantine
      Mechanism Dopaminergic effects
Catechol-O-methyl-transferase  Inhibitor
Dopaminergic effects
Dopamine receptor  Agonist
      Key Mechanism Factor 1
Factor Name Catechol-O-methyl-transferase
×
Structure Sequence
MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
Gene Name COMT
Uniprot ID COMT_HUMAN
KEGG Pathway hsa:1312
Protein Family Class I-like SAM-binding methyltransferase superfamily
Protein Function
Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol.
    Click to Show/Hide
      Key Mechanism Factor 2
Factor Name Dopamine receptor Structure Sequence
Protein Family G-protein coupled receptor 1 family
Protein Function
Dopamine receptor whose activity is mediated by G proteins which activate adenylyl cyclase.
    Click to Show/Hide
      Mechanism Description
  • Additive dopaminergic effects by the combination of Entacapone and Memantine 

References
1 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
2 Multum Information Services, Inc. Expert Review Panel.