Drug General Information (ID: DDIPJMXQ1Y)
  Drug Name Dicyclomine Drug Info Prucalopride Drug Info
  Drug Type Small molecule Small molecule
  Therapeutic Class Anticholinergic Agents Serotoninergic Neuroenteric Modulators
  Structure

 Mechanism of Dicyclomine-Prucalopride Interaction (Severity Level: Moderate)
     Antagonize the effect of cholinergic agents Click to Show/Hide Mechanism Graph
Could Not Find 2D Structure
      Drug Name Dicyclomine Prucalopride
      Mechanism Anticholinergic effects
Muscarinic acetylcholine receptor  Antagonist
Cholinergic effects
5-HT 4 receptor  Agonist
      Key Mechanism Factor 1
Factor Name Muscarinic acetylcholine receptor M Structure Sequence
Protein Family G-protein coupled receptor 1 family
Protein Function
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.
    Click to Show/Hide
      Key Mechanism Factor 2
Factor Name 5-HT 4 receptor
×
Structure Sequence
MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRPQSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSDT
Gene Name HTR4
Uniprot ID 5HT4R_HUMAN
KEGG Pathway hsa:3360
Protein Family G-protein coupled receptor 1 family
Protein Function
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase.
    Click to Show/Hide
      Mechanism Description
  • Antagonize the effect of Prucalopride when combined with Dicyclomine 

Recommended Action
      Management Monitoring for altered efficacy of prucalopride may be advisable during concomitant use with anticholinergic agents.

References
1 EMEA. European Medicines Agency "EPARs. European Union Public Assessment Reports.".
2 Product Information. Resotran (prucalopride). Janssen Pharmaceuticals, Titusville, NJ.