Drug General Information (ID: DDINZGYS0O)
  Drug Name Clopidogrel Drug Info Cangrelor Drug Info
  Drug Type Small molecule Small molecule
  Therapeutic Class Antiplatelet Agents Antiplatelet Agents
  Structure

 Mechanism of Clopidogrel-Cangrelor Interaction (Severity Level: Major)
     Attenuated pharmacological effects (Unspecific) Click to Show/Hide Mechanism Graph
      Drug Name Clopidogrel Cangrelor
      Mechanism Clopidogrel
Irreversible P2Y12 inhibitor  Inhibitor
Decrease the antiplatelet activities of clopidogrel
Reversible P2Y12 inhibitor  Inhibitor
      Key Mechanism Factor 1
Factor Name P2Y purinoceptor 12
×
Structure Sequence
MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
Gene Name P2RY12
Uniprot ID P2Y12_HUMAN
KEGG Pathway hsa:64805
Protein Family G-protein coupled receptor 1 family
Protein Function
Receptor for ADP and ATP coupled to G-proteins that inhibit the adenylyl cyclase second messenger system. Not activated by UDP and UTP. Required for normal platelet aggregation and blood coagulation.
    Click to Show/Hide
      Key Mechanism Factor 2
Factor Name P2Y purinoceptor 12
×
Structure Sequence
MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
Gene Name P2RY12
Uniprot ID P2Y12_HUMAN
KEGG Pathway hsa:64805
Protein Family G-protein coupled receptor 1 family
Protein Function
Receptor for ADP and ATP coupled to G-proteins that inhibit the adenylyl cyclase second messenger system. Not activated by UDP and UTP. Required for normal platelet aggregation and blood coagulation.
    Click to Show/Hide
      Mechanism Description
  • Attenuated pharmacological effects of  Clopidogrel when combined with Cangrelor 

Recommended Action
      Management To maintain platelet inhibition, clopidogrel 600 mg or prasugrel 60 mg should be administered immediately after discontinuation of the cangrelor infusion. Do not administer prior to discontinuation of cangrelor, as clopidogrel and prasugrel will have no antiplatelet effect until the next dose is administered. alternatively, ticagrelor 180 mg may be administered at any time during cangrelor infusion or immediately after discontinuation.

References
1 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
2 Product Information. Kengreal (cangrelor). The Medicines Company, Parsippany, NJ.
3 Dovlatova NL, Jakubowski JA, Sugidachi A, Heptinstall S "The reversible P2Y antagonist cangrelor influences the ability of the active metabolites of clopidogrel and prasugrel to produce irreversible inhibition of platelet function." J Thromb Haemost 6 (2008): 1153-9.[PMID: 18485086]