Details of Drug-Drug Interaction
| Drug General Information (ID: DDINHDPOYR) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Drug Name | Tolcapone | Drug Info | Solriamfetol | Drug Info | |||||
| Drug Type | Small molecule | Small molecule | |||||||
| Therapeutic Class | Antiparkinson Agents | Cns Agents | |||||||
| Structure | |||||||||
| Mechanism of Tolcapone-Solriamfetol Interaction (Severity Level: Moderate) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Additive dopaminergic effects Click to Show/Hide Mechanism Graph | |||||||||
![]() |
|||||||||
| Drug Name | Tolcapone | Solriamfetol | |||||||
| Mechanism |
Dopaminergic effects Catechol-O-methyl-transferase Inhibitor |
Dopaminergic effects Dopamine transporter Inhibitor |
|||||||
| Key Mechanism Factor 1 | |||||||||
| Factor Name | Catechol-O-methyl-transferase |
×
Structure
Sequence
MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
|
|||||||
| Gene Name | COMT | ||||||||
| Uniprot ID | COMT_HUMAN | ||||||||
| KEGG Pathway | hsa:1312 | ||||||||
| Protein Family | Class I-like SAM-binding methyltransferase superfamily | ||||||||
| Protein Function |
Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol.
Click to Show/Hide
|
||||||||
| Key Mechanism Factor 2 | |||||||||
| Factor Name | Dopamine transporter |
×
Structure
Sequence
MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDRETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELALGQFNREGAAGVWKICPILKGVGFTVILISLYVGFFYNVIIAWALHYLFSSFTTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPRWQLTACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAIDGIRAYLSVDFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIVTTSINSLTSFSSGFVVFSFLGYMAQKHSVPIGDVAKDGPGLIFIIYPEAIATLPLSSAWAVVFFIMLLTLGIDSAMGGMESVITGLIDEFQLLHRHRELFTLFIVLATFLLSLFCVTNGGIYVFTLLDHFAAGTSILFGVLIEAIGVAWFYGVGQFSDDIQQMTGQRPSLYWRLCWKLVSPCFLLFVVVVSIVTFRPPHYGAYIFPDWANALGWVIATSSMAMVPIYAAYKFCSLPGSFREKLAYAIAPEKDRELVDRGEVRQFTLRHWLKV
|
|||||||
| Gene Name | SLC6A3 | ||||||||
| Uniprot ID | SC6A3_HUMAN | ||||||||
| KEGG Pathway | hsa:6531 | ||||||||
| Protein Family | Sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family | ||||||||
| Protein Function |
Amine transporter (PubMed:1406597, PubMed:8302271, PubMed:15505207). Terminates the action of dopamine by its high affinity sodium-dependent reuptake into presynaptic terminals (By similarity). Regulator of light-dependent retinal hyaloid vessel regression, downstream of OPN5 signaling (By similarity).
Click to Show/Hide
|
||||||||
| Mechanism Description |
|
||||||||
| Recommended Action | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Management | Caution is advised if solriamfetol is administered concomitantly with other dopaminergic drugs. Dosage adjustments and close patient monitoring should be considered whenever solriamfetol is used with other dopaminergic drugs. | ||||||||
| References | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 1 | Product Information. Sunosi (solriamfetol). Jazz Pharmaceuticals, Palo Alto, CA. | ||||||||||||||||||

