Details of Drug-Drug Interaction
| Drug General Information (ID: DDIJ8BOXF7) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Drug Name | Hydrocortisone | Drug Info | Aliskiren | Drug Info | |||||
| Drug Type | Small molecule | Small molecule | |||||||
| Therapeutic Class | Antiinflammatory Agents | Antihypertensive Agents | |||||||
| Structure | |||||||||
| Mechanism of Hydrocortisone-Aliskiren Interaction (Severity Level: Moderate) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Antagonize the effect of antihypertensive agents Click to Show/Hide Mechanism Graph | |||||||||
 |
|||||||||
| Drug Name | Hydrocortisone | Aliskiren | |||||||
| Mechanism |
Hypertensive effects Induction of sodium and fluid retention |
Antihypertensive agent Angiotensinogenase Inhibitor |
|||||||
| Key Mechanism Factor 1 | |||||||||
| Factor Name | Angiotensinogenase renin |
×
Structure
Sequence
MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
|
|||||||
| Gene Name | REN | ||||||||
| Uniprot ID | RENI_HUMAN | ||||||||
| KEGG Pathway | hsa:5972 | ||||||||
| Protein Family | Peptidase A1 family | ||||||||
| Protein Function |
Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney.
Click to Show/Hide
|
||||||||
| Mechanism Description |
|
||||||||
| Recommended Action | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Management | Patients on prolonged (i.e., longer than about a week) or high-dose corticosteroid therapy should have blood pressure, electrolyte levels, and body weight monitored regularly, and be observed for the development of edema and congestive heart failure. The dosages of antihypertensive medications may require adjustment. | ||||||||
| References | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 1 | Cerner Multum, Inc. "UK Summary of Product Characteristics.". | ||||||||||||||||||
| 2 | Multum Information Services, Inc. Expert Review Panel. | ||||||||||||||||||