Drug General Information (ID: DDIFUREDAH)
  Drug Name Entacapone Drug Info Solriamfetol Drug Info
  Drug Type Small molecule Small molecule
  Therapeutic Class Antiparkinson Agents Cns Agents
  Structure

 Mechanism of Entacapone-Solriamfetol Interaction (Severity Level: Moderate)
     Additive dopaminergic effects Click to Show/Hide Mechanism Graph
Could Not Find 2D Structure
      Drug Name Entacapone Solriamfetol
      Mechanism Dopaminergic effects
Catechol-O-methyl-transferase  Inhibitor
Dopaminergic effects
Dopamine transporter  Inhibitor
      Key Mechanism Factor 1
Factor Name Catechol-O-methyl-transferase
×
Structure Sequence
MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
Gene Name COMT
Uniprot ID COMT_HUMAN
KEGG Pathway hsa:1312
Protein Family Class I-like SAM-binding methyltransferase superfamily
Protein Function
Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol.
    Click to Show/Hide
      Key Mechanism Factor 2
Factor Name Dopamine transporter
×
Structure Sequence
MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDRETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELALGQFNREGAAGVWKICPILKGVGFTVILISLYVGFFYNVIIAWALHYLFSSFTTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPRWQLTACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAIDGIRAYLSVDFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIVTTSINSLTSFSSGFVVFSFLGYMAQKHSVPIGDVAKDGPGLIFIIYPEAIATLPLSSAWAVVFFIMLLTLGIDSAMGGMESVITGLIDEFQLLHRHRELFTLFIVLATFLLSLFCVTNGGIYVFTLLDHFAAGTSILFGVLIEAIGVAWFYGVGQFSDDIQQMTGQRPSLYWRLCWKLVSPCFLLFVVVVSIVTFRPPHYGAYIFPDWANALGWVIATSSMAMVPIYAAYKFCSLPGSFREKLAYAIAPEKDRELVDRGEVRQFTLRHWLKV
Gene Name SLC6A3
Uniprot ID SC6A3_HUMAN
KEGG Pathway hsa:6531
Protein Family Sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family
Protein Function
Amine transporter (PubMed:1406597, PubMed:8302271, PubMed:15505207). Terminates the action of dopamine by its high affinity sodium-dependent reuptake into presynaptic terminals (By similarity). Regulator of light-dependent retinal hyaloid vessel regression, downstream of OPN5 signaling (By similarity).
    Click to Show/Hide
      Mechanism Description
  • Additive dopaminergic effects by the combination of Entacapone and Solriamfetol 

Recommended Action
      Management Caution is advised if solriamfetol is administered concomitantly with other dopaminergic drugs. Dosage adjustments and close patient monitoring should be considered whenever solriamfetol is used with other dopaminergic drugs.

References
1 Product Information. Sunosi (solriamfetol). Jazz Pharmaceuticals, Palo Alto, CA.