Drug General Information (ID: DDI3FB49X1)
  Drug Name Tolcapone Drug Info Methyldopa Drug Info
  Drug Type Small molecule Small molecule
  Therapeutic Class Antiparkinson Agents Antihypertensive Agents
  Structure

 Mechanism of Tolcapone-Methyldopa Interaction (Severity Level: Moderate)
     Non-CYP450 enzyme inhibition Click to Show/Hide Mechanism Graph
Could Not Find 2D Structure
      Drug Name Tolcapone Methyldopa
      Mechanism Catechol-O-methyl-transferase inhibitor Catechol-O-methyl-transferase substrate
      Key Mechanism Factor 1
Factor Name Catechol-O-methyl-transferase
×
Structure Sequence
MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
Gene Name COMT
Uniprot ID COMT_HUMAN
KEGG Pathway hsa:1312
Protein Family Class I-like SAM-binding methyltransferase superfamily
Protein Function
Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol.
    Click to Show/Hide
      Mechanism Description
  • Decreased metabolism of Methyldopa caused by Tolcapone mediated inhibition of non-CYP450 enzyme

Recommended Action
      Management The manufacturer recommends that caution be exercised when these drugs are given together. Monitoring for changes in hemodynamic status and ECG is recommended.

References
1 Illi A, Sundberg S, Ojala-Karlsson P, Korhonen P, Scheinin M, Gordin A "The effect of entacapone on the disposition and hemodynamic effects of intravenous isoproterenol and epinephrine." Clin Pharmacol Ther 58 (1995): 221-7. [PMID: 7648772]
2 Product Information. Comtan (entacapone) Novartis Pharmaceuticals, East Hanover, NJ.
3 Product Information. Ongentys (opicapone). Neurocrine Biosciences, Inc., San Diego, CA.
4 Product Information. Tasmar (tolcapone). Valeant Pharmaceuticals, Costa Mesa, CA.