Details of Drug-Drug Interaction
| Drug General Information (ID: DDIXWN9L7B) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Drug Name | Entacapone | Drug Info | Molindone | Drug Info | |||||
| Drug Type | Small molecule | Small molecule | |||||||
| Therapeutic Class | Antiparkinson Agents | Antipsychotic Agents | |||||||
| Structure | |||||||||
| Mechanism of Entacapone-Molindone Interaction (Severity Level: Moderate) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Additive CNS depression effects Click to Show/Hide Mechanism Graph | |||||||||
![]() |
|||||||||
| Drug Name | Entacapone | Molindone | |||||||
| Mechanism 1 | CNS depression effects | CNS depression effects | |||||||
| Key Mechanism Factor 1 | |||||||||
| Factor Name | CNS depression effects | ||||||||
| Factor Description | CNS depressants are drugs that inhibit or suppress brain activity and can reduce mental and physical processes. Excessive CNS depression can lead to decreased heart rate, slow breathing (less than 10 breaths per minute), extreme confusion or loss of memory, nausea and vomiting, poor judgment, blue lips or fingertips, irritability and aggression, and clammy or cold skin. | ||||||||
| Mechanism Description |
|
||||||||
| Additive hypotensive effects Click to Show/Hide Mechanism Graph | |||||||||
![]() |
|||||||||
| Drug Name | Entacapone | Molindone | |||||||
| Mechanism 2 |
Hypotensive effects Catechol-O-methyl-transferase Inhibitor |
Hypotensive effects Alpha-1 adrenergic receptor Antagonist |
|||||||
| Key Mechanism Factor 2 | |||||||||
| Factor Name | Catechol-O-methyl-transferase |
×
Structure
Sequence
MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
|
|||||||
| Gene Name | COMT | ||||||||
| Uniprot ID | COMT_HUMAN | ||||||||
| KEGG Pathway | hsa:1312 | ||||||||
| Protein Family | Class I-like SAM-binding methyltransferase superfamily | ||||||||
| Protein Function |
Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol.
Click to Show/Hide
|
||||||||
| Key Mechanism Factor 3 | |||||||||
| Factor Name | Adrenergic receptor alpha-1 | Structure Sequence | |||||||
| Protein Family | G-protein coupled receptor 1 family | ||||||||
| Protein Function |
This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins. Nuclear ADRA1A-ADRA1B heterooligomers regulate phenylephrine(PE)-stimulated ERK signaling in cardiac myocytes.
Click to Show/Hide
|
||||||||
| Mechanism Description |
|
||||||||
| Antagonize the effect of dopaminergic agents Click to Show/Hide Mechanism Graph | |||||||||
![]() |
|||||||||
| Drug Name | Entacapone | Molindone | |||||||
| Mechanism 3 |
Dopaminergic agent Catechol-O-methyl-transferase Inhibitor |
Antidopaminergic effects Dopamine receptor Antagonist |
|||||||
| Key Mechanism Factor 4 | |||||||||
| Factor Name | Catechol-O-methyl-transferase |
×
Structure
Sequence
MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
|
|||||||
| Gene Name | COMT | ||||||||
| Uniprot ID | COMT_HUMAN | ||||||||
| KEGG Pathway | hsa:1312 | ||||||||
| Protein Family | Class I-like SAM-binding methyltransferase superfamily | ||||||||
| Protein Function |
Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol.
Click to Show/Hide
|
||||||||
| Key Mechanism Factor 5 | |||||||||
| Factor Name | Dopamine receptor | Structure Sequence | |||||||
| Protein Family | G-protein coupled receptor 1 family | ||||||||
| Protein Function |
Dopamine receptor whose activity is mediated by G proteins which activate adenylyl cyclase.
Click to Show/Hide
|
||||||||
| Mechanism Description |
|
||||||||
| Recommended Action | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Management | Concomitant use of dopaminergic drugs with antidopaminergic agents should generally be avoided. If coadministration is necessary, patients should be alerted to the possibility of excessive drowsiness and monitored for potentially diminished therapeutic response to both treatments. Patients treated for Parkinson's disease should generally avoid antidopaminergic agents, particularly phenothiazines and older neuroleptic agents, since these agents may cause extrapyramidal reactions and exacerbate the symptoms of Parkinson's disease. Likewise, patients with a major psychotic disorder should ordinarily not be treated with dopaminergic drugs because of the risk of exacerbating the psychosis with an increase in central dopaminergic tone. | ||||||||



