Drug General Information (ID: DDIURSDYQ1)
  Drug Name Atenolol Drug Info Mephentermine Drug Info
  Drug Type Small molecule Small molecule
  Therapeutic Class Antihypertensive Agents Vasoconstrictor Agents
  Structure

 Mechanism of Atenolol-Mephentermine Interaction (Severity Level: Moderate)
     Antagonize the effect of antihypertensive agents Click to Show/Hide Mechanism Graph
Could Not Find 2D Structure
      Drug Name Atenolol Mephentermine
      Mechanism Antihypertensive agent
Beta adrenergic receptor  Antagonist
Hypertensive effects
Dopamine D2 receptor  Agonist
      Key Mechanism Factor 1
Factor Name Adrenergic receptor beta Structure Sequence
Protein Family G-protein coupled receptor 1 family
Protein Function
Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity. Mediates Ras activation through G(s)-alpha- and cAMP-mediated signaling. Involved in the regulation of sleep/wake behaviors (PubMed:31473062).
    Click to Show/Hide
      Key Mechanism Factor 2
Factor Name Dopamine D2 receptor
×
Structure Sequence
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC
Gene Name DRD2
Uniprot ID DRD2_HUMAN
KEGG Pathway hsa:1813
Protein Family G-protein coupled receptor 1 family
Protein Function
Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase (PubMed:21645528). Positively regulates postnatal regression of retinal hyaloid vessels via suppression of VEGFR2/KDR activity, downstream of OPN5 (By similarity).
    Click to Show/Hide
      Mechanism Description
  • Antagonize the effect of Atenolol when combined with Mephentermine 

Recommended Action
      Management No specific intervention is necessary, but clinicians should be alert to the potential for diminished cardiac response when pressor agents are used in patients treated with beta-blockers, including ophthalmic formulations. A beta-blocker such as propranolol may be used to treat cardiac arrhythmias that occur during administration of pressor agents like mephentermine, metaraminol, norepinephrine, or phenylephrine.

References
1 Product Information. Dobutrex (dobutamine). Lilly, Eli and Company, Indianapolis, IN.
2 Richards DA, Prichard BN, Hernandez R "Circulatory effects of noradrenaline and adrenaline before and after labetalol." Br J Clin Pharmacol 7 (1979): 371-8.[PMID: 444356]
3 Product Information. Intropin (dopamine). DuPont Pharmaceuticals, Wilmington, DE.