Drug General Information (ID: DDIT4MP3VE)
  Drug Name Botulinum Toxin Type B Drug Info Glycopyrronium Drug Info
  Drug Type Protein/peptide Small molecule
  Therapeutic Class Antidystonic Agents Topical Agents

 Mechanism of Botulinum Toxin Type B-Glycopyrronium Interaction (Severity Level: Moderate)
     Additive anticholinergic effects Click to Show/Hide Mechanism Graph
Could Not Find 2D Structure
      Drug Name Botulinum Toxin Type B Glycopyrronium
      Mechanism Anticholinergic effects
Vesicle-associated membrane protein  Inhibitor
Anticholinergic effects
Muscarinic acetylcholine receptor  Antagonist
      Key Mechanism Factor 1
Factor Name Vesicle-associated membrane protein 2
×
Structure Sequence
MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
Gene Name VAMP2
Uniprot ID VAMP2_HUMAN
KEGG Pathway hsa:6844
Protein Family Synaptobrevin family
Protein Function
Involved in the targeting and/or fusion of transport vesicles to their target membrane (By similarity). Major SNARE protein of synaptic vesicles which mediates fusion of synaptic vesicles to release neurotransmitters. Essential for fast vesicular exocytosis and activity-dependent neurotransmitter release as well as fast endocytosis that mediates rapid reuse of synaptic vesicles (By similarity) (PubMed:30929742). Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.
    Click to Show/Hide
      Key Mechanism Factor 2
Factor Name Muscarinic acetylcholine receptor M Structure Sequence
Protein Family G-protein coupled receptor 1 family
Protein Function
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.
    Click to Show/Hide
      Mechanism Description
  • Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Glycopyrronium 

Recommended Action
      Management Patients should be advised that systemic anticholinergic side effects such as dry mouth, blurred vision, and urinary disorders may increase if agents with anticholinergic properties (e.g., sedating antihistamines antispasmodics neuroleptics phenothiazines skeletal muscle relaxants tricyclic antidepressants disopyramide) are used after administration of botulinum toxin.

References
1 Product Information. Botox (onabotulinumtoxin A). Allergan Inc, Irvine, CA.
2 Product Information. Myobloc (botulinum toxin type B) Elan Pharmaceuticals, S. San Francisco, CA.
3 Product Information. Xeomin (botulinum toxin type A (obsolete) (botulinum toxin type A)). Merz Pharmaceuticals, Greensboro, NC.