Drug General Information (ID: DDIBKZEONR)
  Drug Name Reteplase Drug Info Aprotinin Drug Info
  Drug Type Protein/peptide Small molecule
  Therapeutic Class Thrombolytics Serine Protease Inhibitor

 Mechanism of Reteplase-Aprotinin Interaction (Severity Level: Moderate)
     Antagonize the effect of antithrombotic agents Click to Show/Hide Mechanism Graph
Could Not Find 2D Structure
      Drug Name Reteplase Aprotinin
      Mechanism Thrombolytic agent Thrombogenic effects
      Key Mechanism Factor 1
Factor Name Plasminogen
×
Structure Sequence
MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Gene Name PLG
Uniprot ID PLMN_HUMAN
KEGG Pathway hsa:5340
Protein Family Peptidase S1 family, Plasminogen subfamily
Protein Function
Plasmin dissolves the fibrin of blood clots and acts as a proteolytic factor in a variety of other processes including embryonic development, tissue remodeling, tumor invasion, and inflammation. In ovulation, weakens the walls of the Graafian follicle. It activates the urokinase-type plasminogen activator, collagenases and several complement zymogens, such as C1 and C5. Cleavage of fibronectin and laminin leads to cell detachment and apoptosis. Also cleaves fibrin, thrombospondin and von Willebrand factor. Its role in tissue remodeling and tumor invasion may be modulated by CSPG4. Binds to cells.
    Click to Show/Hide
      Mechanism Description
  • Antagonize the effect of Reteplase when combined with Aprotinin 

Recommended Action
      Management No specific intervention is warranted, but clinicians should be alert to the potential for diminished therapeutic efficacy if a tissue plasminogen activator is administered to a patient who has been treated with an antifibrinolytic agent, and vice versa.

References
1 Product Information. LYSTEDA (tranexamic acid). Xanodyne Pharmaceuticals Inc, Newport, KY.
2 Product Information. Cyklokapron (tranexamic acid). Pharmacia and Upjohn, Kalamazoo, MI.
3 Product Information. Trasylol (aprotinin). Bayer, West Haven, CT.