Details of Drug-Drug Interaction
| Drug General Information (ID: DDIAH2CMK6) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Drug Name | Mesalazine | Drug Info | Azathioprine | Drug Info | |||||
| Drug Type | Small molecule | Small molecule | |||||||
| Therapeutic Class | Antiinflammatory Agents | Immunosuppressive Agents | |||||||
| Structure | |||||||||
| Mechanism of Mesalazine-Azathioprine Interaction (Severity Level: Moderate) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Non-CYP450 enzyme inhibition Click to Show/Hide Mechanism Graph | |||||||||
![]() |
|||||||||
| Drug Name | Mesalazine | Azathioprine | |||||||
| Mechanism | Thiopurine methyltransferase inhibitor | Thiopurine methyltransferase substrate | |||||||
| Key Mechanism Factor 1 | |||||||||
| Factor Name | Thiopurine methyltransferase |
×
Structure
Sequence
MDGTRTSLDIEEYSDTEVQKNQVLTLEEWQDKWVNGKTAFHQEQGHQLLKKHLDTFLKGKSGLRVFFPLCGKAVEMKWFADRGHSVVGVEISELGIQEFFTEQNLSYSEEPITEIPGTKVFKSSSGNISLYCCSIFDLPRTNIGKFDMIWDRGALVAINPGDRKCYADTMFSLLGKKFQYLLCVLSYDPTKHPGPPFYVPHAEIERLFGKICNIRCLEKVDAFEERHKSWGIDCLFEKLYLLTEK
|
|||||||
| Gene Name | TPMT | ||||||||
| Uniprot ID | TPMT_HUMAN | ||||||||
| KEGG Pathway | hsa:7172 | ||||||||
| Protein Family | Class I-like SAM-binding methyltransferase superfamily | ||||||||
| Protein Function |
Catalyzes the S-methylation of thiopurine drugs such as 6-mercaptopurine (also called mercaptopurine, 6-MP or its brand name Purinethol) and 6-thioguanine (also called tioguanine or 6-TG) using S-adenosyl-L-methionine as the methyl donor (PubMed:657528, PubMed:18484748). TPMT activity modulates the cytotoxic effects of thiopurine prodrugs. A natural substrate for this enzyme has yet to be identified.
Click to Show/Hide
|
||||||||
| Mechanism Description |
|
||||||||
| Recommended Action | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Management | Caution is advised if aminosalicylate derivatives must be used concomitantly with purine antagonist antimetabolites. Patients receiving the combination should be closely monitored for hematologic toxicity, and the antimetabolite dosage adjusted accordingly. | ||||||||

