Drug General Information (ID: DDI2LVHJRM)
  Drug Name Phenytoin Drug Info Busulfan Drug Info
  Drug Type Small molecule Small molecule
  Therapeutic Class Anticonvulsants Antineoplastics
  Structure

 Mechanism of Phenytoin-Busulfan Interaction (Severity Level: Moderate)
     Attenuated pharmacological effects (Unspecific) Click to Show/Hide Mechanism Graph
      Drug Name Phenytoin Busulfan
      Mechanism Glutathione-S-transferase inducer Glutathione-S-transferase substrate
      Key Mechanism Factor 1
Factor Name Glutathione S-transferase A3
×
Structure Sequence
MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF
Gene Name GSTA3
Uniprot ID GSTA3_HUMAN
KEGG Pathway hsa:2940
Protein Family GST superfamily, Alpha family
Protein Function
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Catalyzes isomerization reactions that contribute to the biosynthesis of steroid hormones. Efficiently catalyze obligatory double-bond isomerizations of delta(5)-androstene-3,17-dione and delta(5)-pregnene-3,20-dione, precursors to testosterone and progesterone, respectively. Has substantial activity toward aflatoxin B1-8,9-epoxide (By similarity).
    Click to Show/Hide
      Mechanism Description
  • Attenuated pharmacological effects of  Phenytoin when combined with Busulfan 

Recommended Action
      Management Because busulfan crosses the blood brain barrier and may induce seizures, anticonvulsants are typically employed prophylactically when high-dose busulfan is given for myeloablative conditioning. Some manufacturers recommend that all patients receiving high-dose busulfan be premedicated with phenytoin, in which case the dosing may already have taken into account the interaction. Nevertheless, clinical and laboratory monitoring of patient response to busulfan and phenytoin should be performed. The same manufacturers further suggest that use of other anticonvulsants such as benzodiazepines may result in higher busulfan exposure, which may increase the risk of veno-occlusive disease, seizures, and other serious adverse effects. Therefore, plasma busulfan levels should be closely monitored, and patients observed for development of toxicity. By contrast, some manufacturers recommend using a benzodiazepine such as clonazepam, diazepam, or lorazepam rather than an enzyme-inducing anticonvulsant.

References
1 Sandstrom M, Karlsson MO, Ljungman P, et al. "Population pharmacokinetic analysis resulting in a tool for dose individualization of busulphan in bone marrow transplantation recipients." Bone Marrow Transplant 28 (2001): 657-664
2 Hassan M, Oberg G, Bjorkholm M, Wallin I, Lindgren M "Influence of prophylactic anticonvulsant therapy on high-dose busulphan kinetics." Cancer Chemother Pharmacol 33 (1993): 181-6
3 Carreras E, Cahn JY, Puozzo C, et al. "Influence on Busilvex pharmacokinetics of clonazepam compared to previous phenytoin historical data." Anticancer Res 30 (2010): 2977-84