Details of Drug-Drug Interaction
| Drug General Information (ID: DDI1HGTSJL) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Drug Name | Tolcapone | Drug Info | Epinephrine (ophthalmic) | Drug Info | |||||
| Drug Type | Small molecule | Small molecule | |||||||
| Therapeutic Class | Antiparkinson Agents | Vasoconstrictor Agents | |||||||
| Structure | |||||||||
| Mechanism of Tolcapone-Epinephrine (ophthalmic) Interaction (Severity Level: Moderate) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Non-CYP450 enzyme inhibition Click to Show/Hide Mechanism Graph | |||||||||
![]() |
|||||||||
| Drug Name | Tolcapone | Epinephrine (ophthalmic) | |||||||
| Mechanism | Catechol-O-methyl-transferase inhibitor | Catechol-O-methyl-transferase substrate | |||||||
| Key Mechanism Factor 1 | |||||||||
| Factor Name | Catechol-O-methyl-transferase |
×
Structure
Sequence
MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
|
|||||||
| Gene Name | COMT | ||||||||
| Uniprot ID | COMT_HUMAN | ||||||||
| KEGG Pathway | hsa:1312 | ||||||||
| Protein Family | Class I-like SAM-binding methyltransferase superfamily | ||||||||
| Protein Function |
Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol.
Click to Show/Hide
|
||||||||
| Mechanism Description |
|
||||||||
| Recommended Action | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Management | The manufacturer recommends that caution be exercised when these drugs are given together. Monitoring for changes in hemodynamic status and ECG is recommended. | ||||||||

