Drug General Information (ID: DDI13DGVHM)
  Drug Name Dopamine Drug Info Metoclopramide Drug Info
  Drug Type Small molecule Small molecule
  Therapeutic Class Cardiotonic Agents Antiemetics
  Structure

 Mechanism of Dopamine-Metoclopramide Interaction (Severity Level: Minor)
     Antagonize the effect of dopaminergic agents Click to Show/Hide Mechanism Graph
Could Not Find 2D Structure
      Drug Name Dopamine Metoclopramide
      Mechanism Dopaminergic effects
Dopamine D2 receptor  Agonist
Antidopaminergic effects
Dopamine D2 receptor  Antagonist
      Key Mechanism Factor 1
Factor Name Dopamine D2 receptor
×
Structure Sequence
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC
Gene Name DRD2
Uniprot ID DRD2_HUMAN
KEGG Pathway hsa:1813
Protein Family G-protein coupled receptor 1 family
Protein Function
Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase (PubMed:21645528). Positively regulates postnatal regression of retinal hyaloid vessels via suppression of VEGFR2/KDR activity, downstream of OPN5 (By similarity).
    Click to Show/Hide
      Mechanism Description
  • Antagonize the effect of Dopamine when combined with Metoclopramide 

References
1 Gilman AG, Rall TW, Nies AS, Taylor P, eds. "Goodman and Gilman's the Pharmacological Basis of Therapeutics. 8th ed." New York, NY: Pergamon Press Inc. (1990):.
2 Product Information. Fycompa (perampanel). Eisai Inc, Teaneck, NJ.
3 MacDonald TM "Metoclopramide, domperidone and dopamine in man: actions and interactions." Eur J Clin Pharmacol 40 (1991): 225-30