Details of Drug

Drug General Information (ID: D0392)
Drug Name	Corticotropin
Drug Type	Hormones
Drug Synonymous	corticotropin; ACTH; Cortrophin; Corticotrophin; Adrenocorticotropic hormone; Corticotrophine; Corticotrofina; Acthargel; Corticotrophinum; beta-Corticotropin; Adrenocorticotrophin; Purified Cortrophin gel; Corticotropin [USP:INN]; 9002-60-2; CHEBI:3892; BDBM82408; ACTH-(1-39); 25-Asp-30-Gln-corticotropin porcine; NCGC00167127-01; CAS_12279-41-3; Adrenocorticotropic Hormone (1-39), human; LS-187380; SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF; J-004856; alpha1-39-Corticotropin (swine), 25-L-aspartic acid-30-L-glutamine Click to Show/Hide
Disease Class	GB61: Chronic kidney disease; 5A70: Cushing syndrome
Therapeutic Class	Corticosteroids
Structure
Structure	3D Structure		2D Structure
Formula	C207H308N56O58S
InChI	1S/C207H308N56O58S/c1-108(2)89-140(186(302)240-135(69-74-163(279)280)182(298)254-149(204(320)321)94-117-43-20-15-21-44-117)250-193(309)152-54-35-86-262(152)202(318)147(92-116-41-18-14-19-42-116)252-171(287)114(11)230-175(291)132(66-71-160(273)274)234-170(286)113(10)231-191(307)150(105-265)255-183(299)136(70-75-164(281)282)241-190(306)146(98-165(283)284)249-180(296)133(67-72-161(275)276)235-169(285)112(9)229-157(270)101-225-174(290)145(97-156(213)269)251-194(310)153-55-36-87-263(153)203(319)148(93-119-60-64-123(268)65-61-119)253-199(315)167(110(5)6)257-185(301)129(49-26-30-79-210)243-198(314)168(111(7)8)259-196(312)155-57-38-85-261(155)201(317)139(53-34-83-223-207(218)219)244-178(294)130(51-32-81-221-205(214)215)237-177(293)128(48-25-29-78-209)236-176(292)127(47-24-28-77-208)232-158(271)103-227-197(313)166(109(3)4)258-195(311)154-56-37-84-260(154)200(316)138(50-27-31-80-211)233-159(272)102-226-173(289)143(95-120-99-224-126-46-23-22-45-124(120)126)247-179(295)131(52-33-82-222-206(216)217)238-187(303)142(90-115-39-16-13-17-40-115)246-189(305)144(96-121-100-220-107-228-121)248-181(297)134(68-73-162(277)278)239-184(300)137(76-88-322-12)242-192(308)151(106-266)256-188(304)141(245-172(288)125(212)104-264)91-118-58-62-122(267)63-59-118/h13-23,39-46,58-65,99-100,107-114,125,127-155,166-168,224,264-268H,24-38,47-57,66-98,101-106,208-212H2,1-12H3,(H2,213,269)(H,220,228)(H,225,290)(H,226,289)(H,227,313)(H,229,270)(H,230,291)(H,231,307)(H,232,271)(H,233,272)(H,234,286)(H,235,285)(H,236,292)(H,237,293)(H,238,303)(H,239,300)(H,240,302)(H,241,306)(H,242,308)(H,243,314)(H,244,294)(H,245,288)(H,246,305)(H,247,295)(H,248,297)(H,249,296)(H,250,309)(H,251,310)(H,252,287)(H,253,315)(H,254,298)(H,255,299)(H,256,304)(H,257,301)(H,258,311)(H,259,312)(H,273,274)(H,275,276)(H,277,278)(H,279,280)(H,281,282)(H,283,284)(H,320,321)(H4,214,215,221)(H4,216,217,222)(H4,218,219,223)/t112-,113-,114-,125-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,138-,139-,140-,141-,142-,143-,144-,145-,146-,147-,148-,149-,150-,151-,152-,153-,154-,155-,166-,167-,168-/m0/s1
InChIKey	IDLFZVILOHSSID-OVLDLUHVSA-N
Canonical SMILES	CC(C)CC(C(=O)NC(CCC(=O)O)C(=O)NC(CC1=CC=CC=C1)C(=O)O)NC(=O)C2CCCN2C(=O)C(CC3=CC=CC=C3)NC(=O)C(C)NC(=O)C(CCC(=O)O)NC(=O)C(C)NC(=O)C(CO)NC(=O)C(CCC(=O)O)NC(=O)C(CC(=O)O)NC(=O)C(CCC(=O)O)NC(=O)C(C)NC(=O)CNC(=O)C(CC(=O)N)NC(=O)C4CCCN4C(=O)C(CC5=CC=C(C=C5)O)NC(=O)C(C(C)C)NC(=O)C(CCCCN)NC(=O)C(C(C)C)NC(=O)C6CCCN6C(=O)C(CCCNC(=N)N)NC(=O)C(CCCNC(=N)N)NC(=O)C(CCCCN)NC(=O)C(CCCCN)NC(=O)CNC(=O)C(C(C)C)NC(=O)C7CCCN7C(=O)C(CCCCN)NC(=O)CNC(=O)C(CC8=CNC9=CC=CC=C98)NC(=O)C(CCCNC(=N)N)NC(=O)C(CC1=CC=CC=C1)NC(=O)C(CC1=CN=CN1)NC(=O)C(CCC(=O)O)NC(=O)C(CCSC)NC(=O)C(CO)NC(=O)C(CC1=CC=C(C=C1)O)NC(=O)C(CO)N
External Link
	Pubchem ID	16132265
	CAS Number	12427-33-7
	CHEBI ID	3892
	TTD ID	D0R4HQ
	INTEDE ID	DR0383

Drug-Drug Interaction Network
Sunburst Graph		Legend Information AM003 Affected organization distribution AM004 Affected intra/extra-hepatic metabolism AM006 Pharmacodynamic additive effects AM007 Pharmacodynamic antagonistic effects BM014 Interference of cell/tissue uptake BM015 Increase globulin concentration BM017 CYP450 enzyme inhibition BM022 CYP450 enzyme induction BM043 Additive immunosuppressive effects BM050 Increased risk of bleeding BM065 Increased risk of hypokalemia BM069 Increased risk of lowers seizure threshold BM081 Increased risk of ventricular arrhythmias BM083 Potentiated the pharmacological effects (Unspecific) BM086 Antagonize the effect of antidiabetic agents BM089 Antagonize the effect of antihypertensive agents BM091 Antagonize the effect of cholinergic agents BM092 Antagonize the effect of corticosteroids BM100 Antagonize the effect of vaccine/toxoid BM105 Antagonize the effect of probiotics BM106 Diminish the response to diagnostic skin test antigens BM107 Attenuated pharmacological effects (Unspecific)
Relation Graph

Full list of drugs interacting with Corticotropin
Affected organization distribution
	Interference of cell/tissue uptake					Drug Num: 1
Drug ID		Drug Name	Formula	Pubchem ID	Severity Level		Interaction Detail	REF
D1817		Indium In-111 oxyquinoline	C27H18InN3O3	16685037	Moderate		Inter Info	[93]
	Increase globulin concentration					Drug Num: 14
Drug ID		Drug Name	Formula	Pubchem ID	Severity Level		Interaction Detail	REF
D0387		Conjugated estrogens	C18H21NaO5S	45357473	Moderate		Inter Info	[77], [78], [79]
D0388		Conjugated estrogens (topical)	C18H21NaO5S	45357473	Moderate		Inter Info	[77], [78], [79]
D0605		Esterified estrogens	NA	NA	Moderate		Inter Info	[77], [78], [79]
D0610		Estrone sulfate	C18H22O5S	3001028	Moderate		Inter Info	[77], [78], [79]
D0611		Estrone sulfate (topical)	C18H22O5S	3001028	Moderate		Inter Info	[77], [78], [79]
D1011		Mestranol	C21H26O2	6291	Moderate		Inter Info	[77], [78], [79]
D1370		Quinestrol	C25H32O2	9046	Moderate		Inter Info	[77], [78], [79]
D0484		Dienestrol (topical)	C18H18O2	667476	Moderate		Inter Info	[77], [78], [79]
D0487		Diethylstilbestrol	C18H20O2	448537	Moderate		Inter Info	[77], [78], [79]
D0606		Estradiol	C18H24O2	5757	Moderate		Inter Info	[77], [78], [79]
D0607		Estradiol (topical)	C18H24O2	5757	Moderate		Inter Info	[77], [78], [79]
D0608		Estramustine	C23H31Cl2NO3	259331	Moderate		Inter Info	[77], [78], [79]
D0609		Estrone	C18H22O2	5870	Moderate		Inter Info	[77], [78], [79]
D0619		Ethinylestradiol	C20H24O2	5991	Moderate		Inter Info	[77], [78], [79]
Affected intra/extra-hepatic metabolism
	CYP450 enzyme induction					Drug Num: 9
Drug ID		Drug Name	Formula	Pubchem ID	Severity Level		Interaction Detail	REF
D0224		Butabarbital	C10H16N2O3	2479	Moderate		Inter Info	[63], [64], [65], [24], [66], [67], [68], [69], [70], [71]
D0225		Butalbital	C11H16N2O3	2481	Moderate		Inter Info	[63], [64], [65], [24], [66], [67], [68], [69], [70], [71]
D0255		Carbamazepine	C15H12N2O	2554	Moderate		Inter Info	[72], [73], [74], [75], [76]
D0071		Amobarbital	C11H18N2O3	2164	Moderate		Inter Info	[63], [64], [65], [24], [66], [67], [68], [69], [70], [71]
D1040		Methylphenobarbital	C13H14N2O3	8271	Moderate		Inter Info	[65], [69], [70]
D1248		Pentobarbital	C11H18N2O3	4737	Moderate		Inter Info	[63], [64], [65], [24], [66], [67], [68], [69], [70], [71]
D1265		Phenobarbital	C12H12N2O3	4763	Moderate		Inter Info	[63], [64], [65], [24], [66], [67], [68], [69], [70], [71]
D1340		Primidone	C12H14N2O2	4909	Moderate		Inter Info	[63], [64], [65], [24], [66], [67], [68], [69], [70], [71]
D1453		Secobarbital	C12H18N2O3	5193	Moderate		Inter Info	[63], [64], [65], [24], [66], [67], [68], [69], [70], [71]
Pharmacodynamic additive effects
	Additive immunosuppressive effects					Drug Num: 30
Drug ID		Drug Name	Formula	Pubchem ID	Severity Level		Interaction Detail	REF
D0023		Adalimumab	NA	NA	Major		Inter Info	[1], [2], [3], [4], [5], [6]
D0348		Cladribine	C10H12ClN5O3	20279	Major		Inter Info	[24], [25]
D0146		Baricitinib	C16H17N7O2S	44205240	Major		Inter Info	[29], [24], [30]
D0304		Certolizumab pegol	NA	NA	Major		Inter Info	[1], [5], [6]
D0661		Fingolimod	C19H33NO2	107970	Major		Inter Info	[32]
D0736		Golimumab	NA	NA	Major		Inter Info	[1], [2], [3], [4], [5], [6]
D1211		Ozanimod	C23H24N4O3	52938427	Major		Inter Info	[24], [33]
D1474		Siponimod	C29H35F3N2O3	44599207	Major		Inter Info	[29], [34]
D1556		Teriflunomide	C12H9F3N2O2	54684141	Major		Inter Info	[39], [40]
D1600		Tofacitinib	C16H20N6O	9926791	Major		Inter Info	[41]
D1666		Upadacitinib	C17H19F3N6O	58557659	Major		Inter Info	[42]
D0614		Etanercept	NA	NA	Major		Inter Info	[1], [2], [3], [4], [5], [6]
D0802		Infliximab	NA	NA	Major		Inter Info	[1], [2], [3], [4], [5], [6]
D0900		Leflunomide	C12H9F3N2O2	3899	Major		Inter Info	[39], [40]
D1111		Natalizumab	NA	NA	Major		Inter Info	[45]
D0032		Alefacept	NA	NA	Moderate		Inter Info	[35], [54], [55]
D0033		Alemtuzumab	NA	NA	Moderate		Inter Info	[56]
D0085		Anakinra	C20H23N5O7S2	146171046	Moderate		Inter Info	[60], [61], [62]
D0246		Canakinumab	NA	NA	Moderate		Inter Info	[60], [61], [62]
D0443		Denosumab	NA	NA	Moderate		Inter Info	[91]
D0499		Dimethyl fumarate	C6H8O4	637568	Moderate		Inter Info	[92]
D0507		Diroximel fumarate	C11H13NO6	73330464	Moderate		Inter Info	[92]
D1085		Monomethyl fumarate	C5H6O4	5369209	Moderate		Inter Info	[92]
D1162		Ocrelizumab	NA	NA	Moderate		Inter Info	[96]
D1174		Omacetaxine mepesuccinate	C29H39NO9	285033	Moderate		Inter Info	[97]
D1403		Rilonacept	NA	NA	Moderate		Inter Info	[60], [61], [62]
D1422		Roflumilast	C17H14Cl2F2N2O3	449193	Moderate		Inter Info	[24], [105]
D1671		Ustekinumab	NA	NA	Moderate		Inter Info	[106]
D0553		Efalizumab	NA	NA	Moderate		Inter Info	[107]
D1025		Methotrexate	C20H22N8O5	126941	Moderate		Inter Info	[109], [110], [111]
	Increased risk of bleeding					Drug Num: 1
Drug ID		Drug Name	Formula	Pubchem ID	Severity Level		Interaction Detail	REF
D0447		Desirudin	C287H440N80O110S6	16129703	Major		Inter Info	[31]
	Increased risk of hypokalemia					Drug Num: 53
Drug ID		Drug Name	Formula	Pubchem ID	Severity Level		Interaction Detail	REF
D0012		Acetazolamide	C4H6N4O3S2	1986	Moderate		Inter Info	[50], [51], [52]
D0075		Amphotericin B	C47H73NO17	5280965	Moderate		Inter Info	[50], [51], [52]
D0076		Amphotericin B (cholesteryl sulfate)	C47H73NO17	5280965	Moderate		Inter Info	[50], [51], [52]
D0077		Amphotericin B (lipid complex)	C47H73NO17	5280965	Moderate		Inter Info	[50], [51], [52]
D0078		Amphotericin B (liposomal)	C47H73NO17	5280965	Moderate		Inter Info	[50], [51], [52]
D0158		Bendroflumethiazide	C15H14F3N3O4S2	2315	Moderate		Inter Info	[50], [51], [52]
D0166		Benzthiazide	C15H14ClN3O4S3	2343	Moderate		Inter Info	[50], [51], [52]
D0217		Bumetanide	C17H20N2O5S	2471	Moderate		Inter Info	[50], [51], [52]
D0252		Capreomycin	C50H88N28O15	3000502	Moderate		Inter Info	[50], [51], [52]
D0321		Chlorothiazide	C7H6ClN3O4S2	2720	Moderate		Inter Info	[50], [51], [52]
D0326		Chlorthalidone	C14H11ClN2O4S	2732	Moderate		Inter Info	[50], [51], [52]
D0344		Cisplatin	Cl2H6N2Pt	5702198	Moderate		Inter Info	[50], [51], [52]
D0184		Bisacodyl	C22H19NO4	2391	Moderate		Inter Info	[85], [86], [87]
D0269		Castor oil	C57H104O9	14030006	Moderate		Inter Info	[85], [86], [87]
D0701		Frangula purshiana bark	NA	NA	Moderate		Inter Info	[85], [86], [87]
D0731		Glycerin	C3H8O3	753	Moderate		Inter Info	[85], [86], [87]
D0887		Lactitol	C12H24O11	157355	Moderate		Inter Info	[85], [86], [87]
D0970		Magnesium citrate	C12H10Mg3O14	6099959	Moderate		Inter Info	[85], [86], [87]
D0973		Magnesium hydroxide	H2MgO2	14791	Moderate		Inter Info	[85], [86], [87]
D1069		Mineral oil	NA	NA	Moderate		Inter Info	[85], [86], [87]
D1231		Patiromer	NA	NA	Moderate		Inter Info	[50], [51], [52]
D1266		Phenolphthalein	C20H14O4	4764	Moderate		Inter Info	[85], [86], [87]
D1287		Picosulfuric acid	C18H15NO8S2	5243	Moderate		Inter Info	[85], [86], [87]
D1309		Polyethylene glycol (3350)	C2H6O2	174	Moderate		Inter Info	[85], [86], [87]
D1311		Polythiazide	C11H13ClF3N3O4S3	4870	Moderate		Inter Info	[50], [51], [52]
D1605		Tolevamer	C11H16O3S	58817179	Moderate		Inter Info	[50], [51], [52]
D0479		Diclofenamide	C6H6Cl2N2O4S2	3038	Moderate		Inter Info	[50], [51], [52]
D0613		Etacrynic acid	C13H12Cl2O4	3278	Moderate		Inter Info	[50], [51], [52]
D0694		Foscarnet	CH3O5P	3415	Moderate		Inter Info	[50], [51], [52]
D0704		Furosemide	C12H11ClN2O5S	3440	Moderate		Inter Info	[50], [51], [52]
D0771		Hydrochlorothiazide	C7H8ClN3O4S2	3639	Moderate		Inter Info	[50], [51], [52]
D0775		Hydroflumethiazide	C8H8F3N3O4S2	3647	Moderate		Inter Info	[50], [51], [52]
D0798		Indapamide	C16H16ClN3O3S	3702	Moderate		Inter Info	[50], [51], [52]
D0975		Magnesium sulfate	MgO4S	24083	Moderate		Inter Info	[85], [86], [87]
D1018		Methazolamide	C5H8N4O3S2	4100	Moderate		Inter Info	[50], [51], [52]
D1048		Metolazone	C16H16ClN3O3S	4170	Moderate		Inter Info	[50], [51], [52]
D1570		Theophylline	C7H8N4O2	2153	Moderate		Inter Info	[112], [113], [114]
D1611		Torasemide	C16H20N4O3S	41781	Moderate		Inter Info	[50], [51], [52]
D1633		Trichlormethiazide	C8H8Cl3N3O4S2	5560	Moderate		Inter Info	[50], [51], [52]
D0103		Arformoterol	C19H24N2O4	3083544	Minor		Inter Info	[115], [29], [24], [116]
D0797		Indacaterol	C24H28N2O3	6918554	Minor		Inter Info	[115], [29], [24], [116]
D0924		Levosalbutamol	C13H21NO3	123600	Minor		Inter Info	[29], [24], [116]
D1298		Pirbuterol	C12H20N2O3	4845	Minor		Inter Info	[115], [29], [24], [116]
D1374		Racepinephrine	C9H13NO3	838	Minor		Inter Info	[115], [29], [24], [116]
D1695		Vilanterol	C24H33Cl2NO5	10184665	Minor		Inter Info	[29], [24], [116]
D0691		Formoterol	C19H24N2O4	3410	Minor		Inter Info	[115], [29], [24], [116]
D0854		Isoetharine	C13H21NO3	3762	Minor		Inter Info	[115], [29], [24], [116]
D0859		Isoprenaline	C11H17NO3	3779	Minor		Inter Info	[29], [24], [116]
D1185		Orciprenaline	C11H17NO3	4086	Minor		Inter Info	[29], [24], [116]
D1414		Ritodrine	C17H21NO3	33572	Minor		Inter Info	[115], [29], [24], [116]
D1438		Salbutamol	C13H21NO3	2083	Minor		Inter Info	[29], [24], [116]
D1440		Salmeterol	C25H37NO4	5152	Minor		Inter Info	[115], [29], [24], [116]
D1554		Terbutaline	C12H19NO3	5403	Minor		Inter Info	[115], [29], [24], [116]
	Increased risk of lowers seizure threshold					Drug Num: 2
Drug ID		Drug Name	Formula	Pubchem ID	Severity Level		Interaction Detail	REF
D0220		Bupropion	C13H18ClNO	444	Major		Inter Info	[9], [10], [11], [12], [13], [14], [15], [16], [17], [18], [19], [20], [21], [22], [23]
D0678		Fluphenazine	C22H26F3N3OS	3372	Moderate		Inter Info	[29], [24]
	Increased risk of ventricular arrhythmias					Drug Num: 1
Drug ID		Drug Name	Formula	Pubchem ID	Severity Level		Interaction Detail	REF
D0066		Amiodarone	C25H29I2NO3	2157	Major		Inter Info	[7], [8]
	Potentiated the pharmacological effects (Unspecific)					Drug Num: 7
Drug ID		Drug Name	Formula	Pubchem ID	Severity Level		Interaction Detail	REF
D1042		Methyltestosterone	C20H30O2	6010	Moderate		Inter Info	[94], [95]
D1207		Oxymetholone	C21H32O3	5281034	Moderate		Inter Info	[94], [95]
D1503		Stanozolol	C21H32N2O	25249	Moderate		Inter Info	[94], [95]
D0677		Fluoxymesterone	C20H29FO3	6446	Moderate		Inter Info	[94], [95]
D1195		Oxandrolone	C19H30O3	5878	Moderate		Inter Info	[94], [95]
D1558		Testosterone	C19H28O2	6013	Moderate		Inter Info	[94], [95]
D1559		Testosterone (topical)	C19H28O2	6013	Moderate		Inter Info	[94], [95]
Pharmacodynamic antagonistic effects
	Antagonize the effect of antidiabetic agents					Drug Num: 38
Drug ID		Drug Name	Formula	Pubchem ID	Severity Level		Interaction Detail	REF
D0009		Acarbose	C25H43NO18	41774	Moderate		Inter Info	[46], [47], [48]
D0013		Acetohexamide	C15H20N2O4S	1989	Moderate		Inter Info	[46], [47], [48]
D0325		Chlorpropamide	C10H13ClN2O3S	2727	Moderate		Inter Info	[46], [47], [48]
D0029		Albiglutide	C148H224N40O45	145994868	Moderate		Inter Info	[46], [47], [48]
D0042		Alogliptin	C18H21N5O2	11450633	Moderate		Inter Info	[46], [47], [48]
D0245		Canagliflozin	C24H25FO5S	24812758	Moderate		Inter Info	[46], [47], [48]
D0418		Dapagliflozin	C21H25ClO6	9887712	Moderate		Inter Info	[46], [47], [48]
D0565		Empagliflozin	C23H27ClO7	11949646	Moderate		Inter Info	[46], [47], [48]
D0809		Insulin degludec	C274H411N65O81S6	118984462	Moderate		Inter Info	[46], [47], [48]
D0810		Insulin detemir	C267H402N64O76S6	16137271	Moderate		Inter Info	[46], [47], [48]
D0812		Insulin glulisine	C258H384N64O78S6	16136701	Moderate		Inter Info	[46], [47], [48]
D0930		Linagliptin	C25H28N8O2	10096344	Moderate		Inter Info	[46], [47], [48]
D0936		Liraglutide	C172H265N43O51	16134956	Moderate		Inter Info	[46], [47], [48]
D0941		Lixisenatide	C215H347N61O65S	90472060	Moderate		Inter Info	[46], [47], [48]
D1449		Saxagliptin	C18H25N3O2	11243969	Moderate		Inter Info	[46], [47], [48]
D1784		Exenatide	C184H282N50O60S	45588096	Moderate		Inter Info	[46], [47], [48]
D0727		Glimepiride	C24H34N4O5S	3476	Moderate		Inter Info	[46], [47], [48]
D0728		Glipizide	C21H27N5O4S	3478	Moderate		Inter Info	[46], [47], [48]
D0730		Glyburide	C23H28ClN3O5S	3488	Moderate		Inter Info	[46], [47], [48]
D0811		Insulin glargine	C267H404N72O78S6	118984454	Moderate		Inter Info	[46], [47], [48]
D0813		Insulin human	C257H383N65O77S6	118984375	Moderate		Inter Info	[46], [47], [48]
D0814		Insulin human (inhalation, rapid acting)	C257H383N65O77S6	118984375	Moderate		Inter Info	[46], [47], [48]
D0815		Insulin human (isophane)	C257H383N65O77S6	118984375	Moderate		Inter Info	[46], [47], [48]
D0816		Insulin human (regular)	C257H383N65O77S6	118984375	Moderate		Inter Info	[46], [47], [48]
D0817		Insulin human (zinc extended)	C257H383N65O77S6	118984375	Moderate		Inter Info	[46], [47], [48]
D0818		Insulin human (zinc)	C257H383N65O77S6	118984375	Moderate		Inter Info	[46], [47], [48]
D0819		Insulin lispro	C257H389N65O77S6	16132438	Moderate		Inter Info	[46], [47], [48]
D0820		Insulin lispro (protamine)	C257H389N65O77S6	16132438	Moderate		Inter Info	[46], [47], [48]
D1015		Metformin	C4H11N5	4091	Moderate		Inter Info	[46], [47], [48]
D1064		Miglitol	C8H17NO5	441314	Moderate		Inter Info	[46], [47], [48]
D1294		Pioglitazone	C19H20N2O3S	4829	Moderate		Inter Info	[46], [47], [48]
D1326		Pramlintide	C171H267N51O53S2	70691388	Moderate		Inter Info	[46], [47], [48]
D1392		Repaglinide	C27H36N2O4	65981	Moderate		Inter Info	[46], [47], [48]
D1429		Rosiglitazone	C18H19N3O3S	77999	Moderate		Inter Info	[46], [47], [48]
D1477		Sitagliptin	C16H15F6N5O	4369359	Moderate		Inter Info	[46], [47], [48]
D1601		Tolazamide	C14H21N3O3S	5503	Moderate		Inter Info	[46], [47], [48]
D1603		Tolbutamide	C12H18N2O3S	5505	Moderate		Inter Info	[46], [47], [48]
D1652		Troglitazone	C24H27NO5S	5591	Moderate		Inter Info	[46], [47], [48]
	Antagonize the effect of antihypertensive agents					Drug Num: 65
Drug ID		Drug Name	Formula	Pubchem ID	Severity Level		Interaction Detail	REF
D0010		Acebutolol	C18H28N2O4	1978	Moderate		Inter Info	[24], [49]
D0058		Amiloride	C6H8ClN7O	16231	Moderate		Inter Info	[24], [49]
D0069		Amlodipine	C20H25ClN2O5	2162	Moderate		Inter Info	[24], [49]
D0117		Atenolol	C14H22N2O3	2249	Moderate		Inter Info	[24], [49]
D0156		Benazepril	C24H28N2O5	5362124	Moderate		Inter Info	[24], [49]
D0173		Betaxolol	C18H29NO3	2369	Moderate		Inter Info	[24], [49]
D0188		Bisoprolol	C18H31NO4	2405	Moderate		Inter Info	[24], [49]
D0254		Captopril	C9H15NO3S	44093	Moderate		Inter Info	[24], [49]
D0265		Carteolol	C16H24N2O3	2583	Moderate		Inter Info	[24], [49]
D0267		Carvedilol	C24H26N2O4	2585	Moderate		Inter Info	[24], [49]
D0363		Clonidine	C9H9Cl2N3	2803	Moderate		Inter Info	[24], [49]
D0038		Aliskiren	C30H53N3O6	5493444	Moderate		Inter Info	[24], [49]
D0138		Azilsartan medoxomil	C30H24N4O8	135409642	Moderate		Inter Info	[24], [49]
D0352		Clevidipine	C21H23Cl2NO6	153994	Moderate		Inter Info	[24], [49]
D1779		Dulaglutide	NA	NA	Moderate		Inter Info	[46], [47], [48]
D0911		Levamlodipine	C20H25ClN2O5	9822750	Moderate		Inter Info	[24], [49]
D1114		Nebivolol	C22H25F2NO4	71301	Moderate		Inter Info	[24], [49]
D1244		Penbutolol	C18H29NO2	37464	Moderate		Inter Info	[24], [49]
D1887		Semaglutide	C187H291N45O59	56843331	Moderate		Inter Info	[46], [47], [48]
D0444		Deserpidine	C32H38N2O8	8550	Moderate		Inter Info	[24], [49]
D0474		Diazoxide	C8H7ClN2O2S	3019	Moderate		Inter Info	[24], [49]
D0497		Diltiazem	C22H26N2O4S	39186	Moderate		Inter Info	[24], [49]
D0524		Doxazosin	C23H25N5O5	3157	Moderate		Inter Info	[24], [49]
D0567		Enalapril	C20H28N2O5	5388962	Moderate		Inter Info	[24], [49]
D0585		Eplerenone	C24H30O6	443872	Moderate		Inter Info	[24], [49]
D0587		Eprosartan	C23H24N2O4S	5281037	Moderate		Inter Info	[24], [49]
D0640		Felodipine	C18H19Cl2NO4	3333	Moderate		Inter Info	[24], [49]
D0644		Fenoldopam	C16H16ClNO3	3341	Moderate		Inter Info	[24], [49]
D0695		Fosinopril	C30H46NO7P	55891	Moderate		Inter Info	[24], [49]
D0742		Guanabenz	C8H8Cl2N4	5702063	Moderate		Inter Info	[24], [49]
D0743		Guanadrel	C10H19N3O2	38521	Moderate		Inter Info	[24], [49]
D0744		Guanethidine	C10H22N4	3518	Moderate		Inter Info	[24], [49]
D0745		Guanfacine	C9H9Cl2N3O	3519	Moderate		Inter Info	[24], [49]
D0770		Hydralazine	C8H8N4	3637	Moderate		Inter Info	[24], [49]
D0844		Irbesartan	C25H28N6O	3749	Moderate		Inter Info	[24], [49]
D0865		Isradipine	C19H21N3O5	3784	Moderate		Inter Info	[24], [49]
D0884		Labetalol	C19H24N2O3	3869	Moderate		Inter Info	[24], [49]
D0938		Lisinopril	C21H31N3O5	5362119	Moderate		Inter Info	[24], [49]
D0954		Losartan	C22H23ClN6O	3961	Moderate		Inter Info	[24], [49]
D1035		Methyldopa	C10H13NO4	38853	Moderate		Inter Info	[24], [49]
D1049		Metoprolol	C15H25NO3	4171	Moderate		Inter Info	[24], [49]
D1072		Minoxidil	C9H15N5O	4201	Moderate		Inter Info	[24], [49]
D1082		Moexipril	C27H34N2O7	91270	Moderate		Inter Info	[24], [49]
D1098		Nadolol	C17H27NO4	39147	Moderate		Inter Info	[24], [49]
D1130		Nicardipine	C26H29N3O6	4474	Moderate		Inter Info	[24], [49]
D1134		Nifedipine	C17H18N2O6	4485	Moderate		Inter Info	[24], [49]
D1141		Nisoldipine	C20H24N2O6	4499	Moderate		Inter Info	[24], [49]
D1147		Nitroprusside	C5FeN6O	11953891	Moderate		Inter Info	[24], [49]
D1170		Olmesartan	C24H26N6O3	158781	Moderate		Inter Info	[24], [49]
D1256		Perindopril	C19H32N2O5	107807	Moderate		Inter Info	[24], [49]
D1293		Pindolol	C14H20N2O2	4828	Moderate		Inter Info	[24], [49]
D1331		Prazosin	C19H21N5O4	4893	Moderate		Inter Info	[24], [49]
D1357		Propranolol	C16H21NO2	4946	Moderate		Inter Info	[24], [49]
D1369		Quinapril	C25H30N2O5	54892	Moderate		Inter Info	[24], [49]
D1379		Ramipril	C23H32N2O5	5362129	Moderate		Inter Info	[24], [49]
D1393		Reserpine	C33H40N2O9	5770	Moderate		Inter Info	[24], [49]
D1501		Spironolactone	C24H32O4S	5833	Moderate		Inter Info	[24], [49]
D1545		Telmisartan	C33H30N4O2	65999	Moderate		Inter Info	[24], [49]
D1552		Terazosin	C19H25N5O4	5401	Moderate		Inter Info	[24], [49]
D1585		Timolol	C13H24N4O3S	33624	Moderate		Inter Info	[24], [49]
D1618		Trandolapril	C24H34N2O5	5484727	Moderate		Inter Info	[24], [49]
D1631		Triamterene	C12H11N7	5546	Moderate		Inter Info	[24], [49]
D1643		Trimethaphan	C22H25N2OS+	23576	Moderate		Inter Info	[24], [49]
D1679		Valsartan	C24H29N5O3	60846	Moderate		Inter Info	[24], [49]
D1690		Verapamil	C27H38N2O4	2520	Moderate		Inter Info	[24], [49]
	Antagonize the effect of cholinergic agents					Drug Num: 4
Drug ID		Drug Name	Formula	Pubchem ID	Severity Level		Interaction Detail	REF
D0052		Ambenonium	C28H42Cl2N4O2+2	2131	Moderate		Inter Info	[57], [58], [59]
D1122		Neostigmine	C12H19N2O2+	4456	Moderate		Inter Info	[57], [58], [59]
D0552		Edrophonium	C10H16NO+	3202	Moderate		Inter Info	[57], [58], [59]
D1365		Pyridostigmine	C9H13N2O2+	4991	Moderate		Inter Info	[57], [58], [59]
	Antagonize the effect of corticosteroids					Drug Num: 1
Drug ID		Drug Name	Formula	Pubchem ID	Severity Level		Interaction Detail	REF
D1063		Mifepristone	C29H35NO2	55245	Major		Inter Info	[43], [44]
	Antagonize the effect of vaccine/toxoid					Drug Num: 22
Drug ID		Drug Name	Formula	Pubchem ID	Severity Level		Interaction Detail	REF
D1744		Bacillus calmette-guerin substrain tice live antigen	NA	NA	Major		Inter Info	[26], [27], [28]
D1839		Measles virus vaccine live attenuated	NA	NA	Major		Inter Info	[26], [27], [28]
D1849		Mumps virus strain B level jeryl lynn live antigen	NA	NA	Major		Inter Info	[26], [27], [28]
D1881		Rotavirus vaccine	NA	NA	Major		Inter Info	[26], [27], [28]
D1882		Rubella virus vaccine	NA	NA	Major		Inter Info	[26], [27], [28]
D1890		Smallpox (Vaccinia) Vaccine, Live	NA	NA	Major		Inter Info	[35], [36], [37]
D1897		Talimogene laherparepvec	NA	NA	Major		Inter Info	[38]
D1914		Typhoid vaccine (live)	NA	NA	Major		Inter Info	[26], [27], [28]
D1920		Varicella Zoster Vaccine (Recombinant)	NA	NA	Major		Inter Info	[26], [27], [28]
D1922		Yellow Fever Vaccine	NA	NA	Major		Inter Info	[26], [27], [28]
D0089		Anthrax vaccine	NA	NA	Moderate		Inter Info	[35], [80], [81]
D0755		Hepatitis A Vaccine	NA	NA	Moderate		Inter Info	[35], [80], [81]
D0756		Hepatitis B Vaccine (Recombinant)	NA	NA	Moderate		Inter Info	[35], [80], [81]
D0767		Human papillomavirus type 11 L1 capsid protein antigen	NA	NA	Moderate		Inter Info	[35], [80], [81]
D0803		Influenza A virus A/California/7/2009 (H1N1)-like antigen (propiolactone inactivated)	NA	NA	Moderate		Inter Info	[35], [80], [81]
D0804		Influenza A virus A/Vietnam/1194/2004 (H5N1) antigen (formaldehyde inactivated)	NA	NA	Moderate		Inter Info	[35], [80], [81]
D0999		Meningococcal polysaccharide vaccine group C	NA	NA	Moderate		Inter Info	[35], [80], [81]
D1259		Pfizer-BioNTech Covid-19 Vaccine	NA	NA	Moderate		Inter Info	[98], [35], [29], [99], [100], [101], [80], [102], [103], [104], [81]
D1307		Poliovirus type 1 antigen (formaldehyde inactivated)	NA	NA	Moderate		Inter Info	[35], [80], [81]
D1662		Typhoid vaccine (inactivated)	NA	NA	Moderate		Inter Info	[35], [80], [81]
D1692		Vibrio cholerae CVD 103-HgR strain live antigen	NA	NA	Moderate		Inter Info	[35], [80], [81]
D1838		Lyme disease vaccine (recombinant OspA)	NA	NA	Moderate		Inter Info	[108]
	Antagonize the effect of probiotics					Drug Num: 2
Drug ID		Drug Name	Formula	Pubchem ID	Severity Level		Interaction Detail	REF
D1749		Bifidobacterium longum infantis	NA	NA	Moderate		Inter Info	[82], [83], [84]
D1827		Lactobacillus acidophilus	NA	NA	Moderate		Inter Info	[82], [83], [84]
	Diminish the response to diagnostic skin test antigens					Drug Num: 4
Drug ID		Drug Name	Formula	Pubchem ID	Severity Level		Interaction Detail	REF
D1755		Candida albicans	C29H27N2O12P	118855431	Moderate		Inter Info	[88], [89], [90]
D1765		Coccidioides immitis spherule	NA	NA	Moderate		Inter Info	[88], [89], [90]
D1912		Trichophyton mentagrophytes	NA	NA	Moderate		Inter Info	[88], [89], [90]
D1913		Tuberculin purified protein derivative	NA	NA	Moderate		Inter Info	[88], [89], [90]
	Attenuated pharmacological effects (Unspecific)					Drug Num: 2
Drug ID		Drug Name	Formula	Pubchem ID	Severity Level		Interaction Detail	REF
D0030		Aldesleukin	NA	NA	Moderate		Inter Info	[53]
D1812		Hyaluronidase	C17H24BrNO2	91820602	Minor		Inter Info	[117], [118], [119]

References
1	Product Information. Cimzia (certolizumab). UCB Pharma Inc, Smyrna, GA.
2	Product Information. Enbrel (etanercept). Wyeth-Ayerst Laboratories, Philadelphia, PA.
3	Product Information. Humira (adalimumab). Abbott Pharmaceutical, Abbott Park, IL.
4	Product Information. Remicade (infliximab). Centocor Inc, Malvern, PA.
5	Product Information. Simponi (golimumab). Centocor Inc, Malvern, PA.
6	FDA. U.S. Food and Drug Administration "FDA Drug Safety Communication: Drug labels for the Tumor Necrosis Factor-alpha (TNFa) blockers now include warnings about infection with Legionella and Listeria bacteria. ".
7	Antonelli D, Atar S, Freedberg NA, Rosenfeld T "Torsade de pointes in patients on chronic amiodarone treatment: contributing factors and drug interactions." Isr Med Assoc J 7 (2005): 163-5. [PMID: 15792261]
8	Product Information. Amiodarone Hydrochloride (amiodarone). Bedford Laboratories, Bedford, OH.
9	Product Information. Wellbutrin XL (buPROPion). GlaxoSmithKline, Philadelphia, PA.
10	Sheehan DV, Welch JB, Fishman SM "A case of bupropion-induced seizure." J Nerv Ment Dis 174 (1986): 496-8. [PMID: 3090199]
11	Canadian Pharmacists Association.
12	Product Information. Wellbutrin (bupropion). Glaxo Wellcome, Research Triangle Park, NC.
13	Gittelman DK, Kirby MG "A seizure following bupropion overdose." J Clin Psychiatry 54 (1993): 162. [PMID: 8486598]
14	Product Information. Wellbutrin SR (bupropion). Glaxo Wellcome, Research Triangle Park, NC.
15	James WA, Lippmann S "Bupropion: overview and prescribing guidelines in depression." South Med J 84 (1991): 222-4. [PMID: 1899294]
16	Masco HL, Kiev A, Holloman LC, Batey SR, Johnston JA, Lineberry CG "Safety and efficacy of bupropion and nortriptyline in outpatients with depression." Curr Ther Res Clin Exp 55 (1994): 851-63.
17	Dufresne RL, Weber SS, Becker RE "Bupropion hydrochloride." Drug Intell Clin Pharm 18 (1984): 957-64. [PMID: 6439541]
18	Product Information. Zyban (bupropion). Glaxo Wellcome, Research Triangle Park, NC.
19	Storrow AB "Bupropion overdose and seizure." Am J Emerg Med 12 (1994): 183-4. [PMID: 8161393]
20	Johnston JA, Lineberry CG, Ascher JA, et al. "A 102-center prospective study of seizure in association with bupropion." J Clin Psychiatry 52 (1991): 450-6. [PMID: 1744061]
21	Rosenstein DL, Nelson JC, Jacobs SC "Seizures associated with antidepressants: a review." J Clin Psychiatry 54 (1993): 289-99. [PMID: 8253696]
22	Pisani F, Spina E, Oteri G "Antidepressant drugs and seizure susceptibility: from in vitro data to clinical practice." Epilepsia 40(Suppl 10) (1999): S48-56. [PMID: 10609604]
23	Product Information. Aplenzin (buPROPion). sanofi-aventis , Bridgewater, NJ.
24	Cerner Multum, Inc. "UK Summary of Product Characteristics.".
25	Product Information. Leustatin (cladribine). Ortho Biotech Inc, Raritan, NJ.
26	Fauci AS, Braunwald E, Isselbacher KJ, Wilson JD, Martin JB, Kasper DL, Hauser SL, Longo DL, eds. "Harrison's Principles of Internal Medicine. 14th ed." New York, NY: McGraw-Hill Health Professionals Division (1998).
27	Product Information. Attenuvax (measles virus vaccine, live, attenuated). Merck &amp Co, Inc, West Point, PA.
28	Product Information. YF-Vax (yellow fever vaccine). sanofi pasteur, Swiftwater, PA.
29	Cerner Multum, Inc. "Australian Product Information.".
30	Product Information. Olumiant (baricitinib). Lilly, Eli and Company, Indianapolis, IN.
31	Product Information. Ipravask (desirudin). Aventis Pharmaceuticals, Swiftwater, PA.
32	Product Information. Gilenya (fingolimod). Novartis Pharmaceuticals, East Hanover, NJ.
33	Product Information. Zeposia (ozanimod). Celgene Corporation, Summit, NJ.
34	Product Information. Mayzent (siponimod). Novartis Pharmaceuticals, East Hanover, NJ.
35	CDC. Centers for Disease Control and Prevention/ "Recommendations of the advisory committtee on immunization practices (ACIP): use of vaccines and immune globulins in persons with altered immunocompetence." MMWR Morb Mortal Wkly Rep 42(RR-04) (1993): 1-18. [PMID: 20300058]
36	Product Information. Dryvax (smallpox vaccine). Wyeth-Ayerst Laboratories, Philadelphia, PA.
37	CDC. Centers for Disease Control and Prevention "Clinical guidance for smallpox vaccine use in a postevent vaccination program.".
38	Product Information. Imlygic (talimogene laherparepvec). Amgen USA, Thousand Oaks, CA.
39	Product Information. Arava (leflunomide). Hoechst Marion-Roussel Inc, Kansas City, MO.
40	Product Information. Aubagio (teriflunomide). Genzyme Corporation, Cambridge, MA.
41	Product Information. Xeljanz (tofacitinib). Pfizer U.S. Pharmaceuticals Group, New York, NY.
42	Product Information. Rinvoq (upadacitinib). AbbVie US LLC, North Chicago, IL.
43	Product Information. Korlym (mifepristone). Corcept Therapeutics Incorporated, Menlo Park, CA.
44	Product Information. Mifeprex (mifepristone) Danco Laboratories, New York, NY.
45	Product Information. Tysabri (natalizumab). Elan Pharmaceutical/Athena Neurosciences Inc, South San Francisco, CA.
46	Jori A, Carrara MC "On the mechanism of the hyperglycaemic effect of chlorpromazine." J Pharm Pharmacol 18 (1966): 623-4. [PMID: 4381950]
47	Product Information. Dymelor (acetohexamide) Lilly, Eli and Company, Indianapolis, IN.
48	Product Information. Thorazine (chlorpromazine). SmithKline Beecham, Philadelphia, PA.
49	Multum Information Services, Inc. Expert Review Panel.
50	Morris GC, Egan JG, Jones MK "Hypokalaemic paralysis induced by bolus prednisolone in Graves' disease." Aust N Z J Med 22 (1992): 312. [PMID: 1497563]
51	Thomas TP "The complications of systemic corticosteroid therapy in the elderly." Gerontology 30 (1984): 60-5. [PMID: 6698408]
52	Product Information. Hydeltrasol (prednisolone). Merck &amp Co, Inc, West Point, PA.
53	Product Information. Proleukin (aldesleukin). Chiron Therapeutics, Emeryville, CA.
54	Product Information. Amevive (alefacept). Biogen, Cambridge, MA.
55	Product Information. Lonsurf (tipiracil-trifluridine). Taiho Oncology, Inc., Princeton, NJ.
56	Product Information. Campath (alemtuzumab) Berlex, Richmond, CA.
57	Brunner NG, Namba T, Grob D "Corticosteroids in management of severe, generalized myasthenia gravis." Neurology 22 (1972): 603-10
58	Namba T "Corticotropin therapy in patients with myasthenia gravis." Arch Neurol 26 (1972): 144-50
59	Patten BM, Oliver KL, Engel WK "Adverse interaction between steroid hormones and anticholinesterase drugs." Neurology 24 (1974): 442-9
60	Product Information. Arcalyst (rilonacept). Regeneron Pharmaceuticals Inc, Tarrytown, NY.
61	Product Information. Ilaris (canakinumab). Novartis Pharmaceuticals, East Hanover, NJ.
62	Product Information. Kineret (anakinra). Amgen, Thousand Oaks, CA.
63	Bartoszek M, Brenner AM, Szefler SJ "Prednisolone and methylprednisolone kinetics in children receiving anticonvulsant therapy." Clin Pharmacol Ther 42 (1987): 424-32. [PMID: 3665340]
64	Brooks PM, Buchanan WW, Grove M, Downie WW "Effects of enzyme induction on metabolism of prednisolone." Ann Rheum Dis 35 (1976): 339-43. [PMID: 970991]
65	Brooks SM, Werk EE, Ackerman SJ, Sullivan I, Thrasher K "Adverse effects of phenobarbital on corticosteroid metabolism in patients with bronchial asthma." N Engl J Med 286 (1972): 1125-8. [PMID: 4553339]
66	Gambertoglio JG, Holford NH, Kapusnik JE, et al "Disposition of total and unbound prednisolone in renal transplant patients receiving anticonvulsants." Kidney Int 25 (1984): 119-23. [PMID: 6374250]
67	Hancock KW, Levell MJ "Primidone/dexamethasone interaction." Lancet 2 (1978): 97-8. [PMID: 78317]
68	Product Information. Phenobarbital (phenobarbital). Lilly, Eli and Company, Indianapolis, IN.
69	Sehgal VN, Srivastava G "Corticosteroid-unresponsive pemphigus vulgaris following antiepileptic therapy." Int J Dermatol 27 (1988): 258. [PMID: 3391717]
70	Stjernholm MR, Katz FH "Effects of diphenylhydantoin, phenobarbital, and diazepam on the metabolism of methylprednisolone and its sodium succinate." J Clin Endocrinol Metab 41 (1975): 887-93. [PMID: 1184723]
71	Young MC, Hughes IA "Loss of therapeutic control in congenital adrenal hyperplasia due to interaction between dexamethasone and primidone." Acta Paediatr Scand 80 (1991): 120-4. [PMID: 2028784]
72	Keitner GI, Fruzzetti AE, Miller IW, Norman WH, Brown WA "The effect of anticonvulsants on the dexamethasone suppression test." Can J Psychiatry 34 (1989): 441-3. [PMID: 2766197]
73	Levy RH "Cytochrome P450 isozymes and antiepileptic drug interactions." Epilepsia 36 Suppl 5 (1995): s8-13. [PMID: 8806399]
74	Olivesi A "Modified elimination of prednisolone in epileptic patients on carbamazepine monotherapy, and in women using low-dose oral contraceptives." Biomed Pharmacother 40 (1986): 301-8. [PMID: 3814762]
75	Privitera MR, Greden JF, Gardner RW, Ritchie JC, Calrroll BJ "Interference by carbamazepine with the dexamethasone suppresion test." Biol Psychiatry 17 (1982): 611-20. [PMID: 7093397]
76	Spina E, Pisani F, Perucca E "Clinically significant pharmacokinetic drug interactions with carbamazepine - an update." Clin Pharmacokinet 31 (1996): 198-214. [PMID: 8877250]
77	Legler UF, Benet LZ "Marked alterations in dose-dependent prednisolone kinetics in women taking oral contraceptives." Clin Pharmacol Ther 39 (1986): 425-9
78	Meffin PJ, Wing LM, Sallustio BC, Brooks PM "Alterations in prednisolone as a result of oral contraceptive use and dose." Br J Clin Pharmacol 17 (1984): 655-64
79	Frey BM, Schaad HJ, Frey FJ "Pharmacokinetic interaction of contraceptive steroids with prednisone and prednisolone." Eur J Clin Pharmacol 26 (1984): 505-11
80	Product Information. Imovax Rabies (rabies vaccine). sanofi pasteur, Swiftwater, PA.
81	Department of Health. National Health Service "Immunisation Against Infectious Disease - "The Green Book". Chapter 6: Contraindications and special considerations.".
82	Borriello SP, Hammes WP, Holzapfel W, et.al "Safety of probiotics that contain lactobacilli or bifidobacteria." Clin Infect Dis 36 (2003): 775-80. [PMID: 12627362]
83	Schlegel L, Lemerle S, Geslin P "Lactobacillus species as opportunistic pathogens in immunocompromised patients." Eur J Clin Microbiol Infect Dis 17 (1998): 887-8. [PMID: 10052559]
84	Salminen MK, Tynkkynen S, Rautelin H, et al. "Lactobacillus bacteremia during a rapid increase in probiotic use of Lactobacillus rhamnosus GG in Finland." Clin Infect Dis 35 (2002): 1155-60. [PMID: 12410474]
85	Chin RL "Laxative-induced hypokalemia." Ann Emerg Med 32 (1998): 517-8. [PMID: 9774942]
86	Muller-Lissner SA "Adverse effects of laxatives: fact and fiction." Pharmacology 47 (1993): 138-45. [PMID: 8234421]
87	Leach MJ, Page AT. Herbal medicine for insomnia: A systematic review and meta-analysis. Sleep Med Rev. 2015 Dec;24:1-12.
88	Product Information. Tuberculin PPD (Mantoux) (tuberculin purified protein derivative). Connaught Laboratories Ltd, Toronto, ON.
89	Product Information. Candin (candida albicans extract). Nielsen Biosciences Inc, San Diego, CA.
90	Product Information. Spherulin (coccidioidin skin test). ALK Laboratories Inc, Wallingford, CT.
91	Product Information. Prolia (denosumab). Amgen USA, Thousand Oaks, CA.
92	Product Information. Vumerity (diroximel fumarate). Alkermes, Inc, Cambridge, MA.
93	Product Information. Indium Oxyquinoline In-111 (indium oxyquinoline In-111). GE Healthcare, Princeton, NJ.
94	Product Information. AndroGel (testosterone). Unimed Pharmaceuticals, Buffalo Grove, IL.
95	Product Information. Oxandrin (oxandrolone). Bio-Tech, Levittown, PA.
96	Product Information. Ocrevus (ocrelizumab). Genentech, South San Francisco, CA.
97	Product Information. Synribo (omacetaxine). Teva Pharmaceuticals USA, North Wales, PA.
98	CDC Centers for Disease Control and Prevention "General Best Practice Guidelines for Immunization: Altered Immunocompetence." .
99	Product Information. Biothrax (anthrax vaccine adsorbed). Emergent BioSolutions Inc., Lansing, MI.
100	Product Information. Fluzone Influenza Vaccine (influenza virus vaccine). Connaught, Swiftwater, PA.
101	Product Information. Havrix (hepatitis A vaccine). SmithKline Beecham, Philadelphia, PA.
102	Product Information. Influenza Virus Vaccine, H5N1, Inactivated (influenza virus vaccine, H5N1, inactivated). GlaxoSmithKline, Research Triangle Park, NC.
103	Product Information. Omnihib (haemophilus b conjugate vaccine). SmithKline Beecham, Philadelphia, PA.
104	CDC Centers for Disease Control and Prevention "Interim Clinical Considerations for Use of COVID-19 Vaccines Currently Approved or Authorized in the United States.".
105	Product Information. Daxas (roflumilast). Nycomed Inc, Princeton, NJ.
106	Product Information. Stelara (ustekinumab). Centocor Inc, Malvern, PA.
107	Product Information. Raptiva (efalizumab). Genentech, South San Francisco, CA.
108	Shen AK, Mead PS, Beard CB. The Lyme disease vaccine--a public health perspective. Clin Infect Dis. 2011;52 Suppl 3:s247-s252. [PMID: 21217171]
109	Lafforgue P, Monjanel-Mouterde S, Durand A, Catalin J, Acquaviva PC "Is there an interaction between low doses of corticosteroids and methotrexate in patients with rheumatoid arthritis? A pharmacokinetic study in 33 patients." J Rheumatol 20 (1993): 263-7. [PMID: 8474062]
110	Roenigk HH, Fowler-Bergfeld W, Curtis GH "Methotrexate for psoriasis in weekly oral doses." Arch Dermatol 99 (1969): 86-93. [PMID: 5761810]
111	Wolff JE, Hauch H, Kuhl J, Egeler RM, Jurgens H "Dexamethasone increases hepatotoxicity of MTX in children with brain tumors." Anticancer Res 18 (1998): 2895-900. [PMID: 9713483]
112	Leavengood DC, Bunker-Soler AL, Nelson HS "The effect of corticosteroids on theophylline metabolism." Ann Allergy 50 (1983): 249-51
113	Fergusson RJ, Scott CM, Rafferty P, Gaddie J "Effect of prednisolone on theophylline pharmacokinetics in patients with chronic airflow obstruction." Thorax 42 (1987): 195-8
114	Buchanan N, Hurwitz S, Butler P "Asthma - a possible interaction between hydrocortisone and theophylline." S Afr Med J 56 (1979): 1147-8
115	Agencia Espaola de Medicamentos y Productos Sanitarios Healthcare "Centro de informacion online de medicamentos de la AEMPS - CIMA.".
116	Product Information. Foradil (formoterol) Novartis Pharmaceuticals, East Hanover, NJ.
117	Fuhr U, Maier-Bruggemann A, Blume H, et al. "Grapefruit juice increases oral nimodipine bioavailability." Int J Clin Pharmacol Ther 36 (1998): 126-32. [PMID: 9562227]
118	Gunston GD, Mehta U "Potentially serious drug interactions with grapefruit juice." S Afr Med J 90 (2000): 41. [PMID: 10721388]
119	Product Information. Vitrase (hyaluronidase). Bausch and Lomb, Rochester, NY.

Details of Drug

Details of Drug

Cite MecDDI

About MecDDI

Correspondence